SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene70659

Length: 353 nt

UniGene Fasta

>sp_v3.0_unigene70659
CGTCGTGACCTTGGCTGTCACTCAGTTTTAGTGGCTATAATCAGATTCAGGTAGCACCTAAAGATTAGGATAAGACCACATTTACCTGTCCATGGGGAACTTTTGCTTACCGAGTACTTCCTTTTGGATTATGTAATGCACCTGCAACATTTCAAAGGGCAATACTAGGAATCTTTTCTGATCTAATCCATGATTGTGTAGAGGTTTATATGGATGACTTTACAGTTTATGGTGATTCATTTGAAACTTTGAAAACAAGAATATCTGAAGCACCCATTTTGAGAGGACCAAAATTGGAAACTTCCTTTCCATATTTCTACAGATGCTTCAGATACAGCTCTTGGAGCTGTGTT

Ace file of the UniGene sp_v3.0_unigene70659

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Integrase n=1 Tax=Populus trichocarpa RepID=Q0ZCD0_POPTR	-	-	5.0e-25	61%
FL-Next	sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion.	-	-	0.0	37%
Sma3	Reverse transcriptase	-	-	3.172e-10	-

Source	Gene names
Sma3	19.t00014; 19.t00017; AT4g07600; AT4g07660; GSVIVT00000833001; GSVIVT00005459001; GSVIVT00005481001; GSVIVT00005536001; GSVIVT00005553001; GSVIVT00008081001; GSVIVT00009068001; GSVIVT00009118001; LOC_Os03g41624; OJ1045_C06.5; OSJNBa0036C12.21; OSJNBb0007E

Source	GOs	Term	Type	Identity
Sma3	endoplasmic reticulum	GO:0005783	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	fatty acid biosynthetic process	GO:0006633	Biological Process	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Tobamoviral movement protein	IPR001022	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	KID repeat	IPR003900	-	-
Sma3	Transposon, En/Spm-like	IPR004242	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Nitrite/sulphite reductase iron-sulphur/siroheam-binding site	IPR006066	-	-
Sma3	Zinc finger, PMZ-type	IPR006564	-	-
Sma3	Fatty acid hydroxylase	IPR006694	-	-
Sma3	Zinc finger, SWIM-type	IPR007527	-	-
Sma3	Glycoside hydrolase, family 16, active site	IPR008263	-	-
Sma3	Peptidase aspartic, catalytic	IPR009007	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3	Beta tubulin, autoregulation binding site	IPR013838	-	-
Sma3	Homeobox, conserved site	IPR017970	-	-
Sma3	DNA methylase, N-4 cytosine-specific, conserved site	IPR017985	-	-
Sma3	Aldo/keto reductase, conserved site	IPR018170	-	-
Sma3	Annexin repeat, conserved site	IPR018252	-	-
Sma3	MULE transposase domain	IPR018289	-	-

Source	Species	ID	Description	e value	Identity
RefSeq	Populus trichocarpa	XP_002336419.1	predicted protein, partial [Populus trichocarpa]	2.0e-16	57%

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: sp_plants

Fln subject: P31843

Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 14 aas, your sequence is shorter than subject: 117 - 142

Fln protein: S*PWLSLSFSGYNQIQVAPKD*DKTTFTCPWGTFAYRVLPFGLCNAPATFQRAILGIFSDLIHDCVEVYMDDFTVYGDSFETLKTRISEAPILRGPKLETSFPYFYRCFRYSSWSCV

Protein Length: 118

Fln nts: CGTCGTGACCTTGGCTGTCACTCAGTTTTAGTGGCTATAATCAGATTCAGGTAGCACCTAAAGATTAGGATAAGACCACATTTACCTGTCCATGGGGAACTTTTGCTTACCGAGTACTTCCTTTTGGATTATGTAATGCACCTGCAACATTTCAAAGGGCAATACTAGGAATCTTTTCTGATCTAATCCATGATTGTGTAGAGGTTTATATGGATGACTTTACAGTTTATGGTGATTCATTTGAAACTTTGAAAACAAGAATATCTGAAGCACCCATTTTGAGAGGACCAAAATTGGAAACTTCCTTTCCATATTTCTACAGATGCTTCAGATACAGCTCTTGGAGCTGTGTT

Fln Alignment:

GG46A6U02GRY49___SGYNQIQVAPKD*DKTTFTCPWGTFAYRVLPFGLCNAPATFQRAILGIFSDLIHDCVEVYMDDFTVYGDSFETLKTRISEAPILRGPK
P31843_______________SGYWQVRIAKGDEPKTTCVTRYGSFEFRVMPFGLTNALATFCNLMNNVLYEYLDHFVVVYLDDLVVYTIYSNSLHEHIKHLRVVRESK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain