UniGene Name: sp_v3.0_unigene70549
Length: 242 nt
UniGene Fasta |
---|
>sp_v3.0_unigene70549
C |
Ace file of the UniGene sp_v3.0_unigene70549 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | nucleic acid-binding protein-like [Oryza sativa Japonica Group] | - | - | 2.0e-30 | 90% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
Sma3 | Ribonucleoprotein | - | - | 9.835e-14 | - |
Source | Gene names |
---|---|
Sma3 | At3g23830; At4g24770; At5g50250; CEBP-1; F22K18.30; GRSF; GSVIVT00015937001; GSVIVT00016201001; GSVIVT00020623001; GSVIVT00023204001; LOC_Os03g25960; NBP; OJ1150_A11.19-1; OJ1150_A11.19-2; OSJNBa0042B15.30; OSJNBa0042B15.31; OSJNBa0070E11.4; OSJNBa0070E11 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | ribonucleoprotein complex | GO:0030529 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | double-stranded DNA binding | GO:0003690 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | poly(U) RNA binding | GO:0008266 | Molecular Function | 0.0 | - |
Sma3 | mRNA processing | GO:0006397 | Biological Process | 0.0 | - |
Sma3 | innate immune response | GO:0045087 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | RNA recognition motif domain | IPR000504 | - | 0.0 | - |
Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
Sma3 | Paraneoplastic encephalomyelitis antigen | IPR002343 | - | 0.0 | - |
Sma3 | Raffinose synthase | IPR008811 | - | 0.0 | - |
Sma3 | Nucleotide-binding, alpha-beta plait | IPR012677 | - | 0.0 | - |
Sma3 | IPR015465 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G24770.1 | RBP31, ATRBP31, CP31, ATRBP33 31-kDa RNA binding protein chr4:12766223-12767952 REVERSE LENGTH=329 | 1.0e-27 | 71% |
RefSeq | Arabidopsis thaliana | NP_194208.1 | ribonucleoprotein [Arabidopsis thaliana] | 2.0e-27 | 71% |
RefSeq | Populus trichocarpa | XP_002298568.1 | predicted protein [Populus trichocarpa] | 9.0e-29 | 70% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NWK5
Fln msg: STOP codon was not found. Distance to subject end: 0 aas, your sequence is shorter than subject: 80 - 290
Fln protein:
V
Protein Length:
81
Fln nts:
C
Fln Alignment:
GG46A6U02H7HXI___DSRLVQLFSEHGEVVNATVVYDRETGRSRGFGFVTMASKEDLDSAISALDGQEMDGRPLRVNVAAERPQRGF
A9NWK5_______________DNSLLQLFSEHGKVLEARVVYDRETGRSRGFGFVTYSSESEVNDAIAALDGTDMDGRPLRVNIAEDR-RRGF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain