UniGene Name: sp_v3.0_unigene70517
Length: 209 nt
UniGene Fasta |
---|
>sp_v3.0_unigene70517
C |
Ace file of the UniGene sp_v3.0_unigene70517 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 1.153e-07 | - |
Source | Gene names |
---|---|
Sma3 | At2g01510; At2g22070; At2g33760; At4g01030; At5g19020; F2I9.13; F3I3.50; GSVIVT00001532001; GSVIVT00002423001; GSVIVT00006467001; GSVIVT00006499001; GSVIVT00006853001; GSVIVT00007171001; GSVIVT00011403001; GSVIVT00013497001; GSVIVT00014293001; GSVIVT00014 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | diacylglycerol kinase activity | GO:0004143 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein transporter activity | GO:0008565 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway | GO:0007205 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
Sma3 | RNA metabolic process | GO:0016070 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G33760.1 | Pentatricopeptide repeat (PPR) superfamily protein chr2:14275800-14277551 FORWARD LENGTH=583 | 5.0e-20 | 57% |
RefSeq | Arabidopsis thaliana | NP_180932.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 6.0e-20 | 57% |
RefSeq | Populus trichocarpa | XP_002329756.1 | predicted protein [Populus trichocarpa] | 2.0e-21 | 59% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: Distance to subject end: 37 aas, your sequence is shorter than subject: 69 - 232
Fln protein:
R
Protein Length:
70
Fln nts:
C
Fln Alignment:
GG46A6U02GWH29___SFVGILSACCHAGLVDEGREFFDCMSKHYHITPTIEHYCCMVDLLGRTGFLDEAWNFINKM
D5AB53_______________TFVGVLSACCHAGLVSEGRQYFNSMSVDYHITPVMEHYCCMVDLLGRTGCLDEAHDFINKM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain