|
||||||
|
UniGene Name: sp_v3.0_unigene70485
Length: 241 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene70485
C |
|
Ace file of the UniGene sp_v3.0_unigene70485
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Multicopper oxidase, putative n=1 Tax=Ricinus communis RepID=B9SMP3_RICCO | - | - | 1.0e-26 | 70% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
| Sma3 | Multicopper oxidase, putative | - | - | 1.23801e-40 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidoreductases, Acting on diphenols and related substances as donors, With oxygen as acceptor. | EC:1.10.3.- | - | 2.255e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Betalain biosynthesis | 00965 | 2.255e-07 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.255e-07 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.255e-07 | % | |
| Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 8.584e-29 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 8.584e-29 | % | |
| Sma3 | Metabolic pathways | 01100 | 8.584e-29 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT1G76160; AT4g22010; AT4g28090; AT4g37160; AT4g38420; At1g21850; At1g21860; At1g41830; At1g55560; At1g55560/T5A14_2; At1g55570; At1g75790; At1g76160; At2g23630; At3g13390; At3g13400; At4g12420; At4g22010; At4g25240; At4g28090; At4g37160; At4g38420; At5g5 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | anchored to plasma membrane | GO:0046658 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | pectinesterase activity | GO:0030599 | Molecular Function | 0.0 | - |
| Sma3 | cell tip growth | GO:0009932 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
| Sma3 | IPR013753 | - | 0.0 | - | |
| Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G48450.1 | sks3 SKU5 similar 3 chr5:19632791-19635612 REVERSE LENGTH=621 | 2.0e-32 | 66% |
| RefSeq | Arabidopsis thaliana | NP_199656.2 | protein SKU5 similar 3 [Arabidopsis thaliana] | 2.0e-32 | 66% |
| RefSeq | Populus trichocarpa | XP_002321241.1 | predicted protein [Populus trichocarpa] | 9.0e-33 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRE4
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 468 aas, your sequence is shorter than subject: 80 - 591
Fln protein:
R
Protein Length:
81
Fln nts:
C
Fln Alignment:
GG46A6U02FXU2U___FPGPLVNLDNPIGTAVVNVLNNLDEPFLITWNGLQNRRNSWQDGVSGTNCPIPAGWNWTYNFQAKDQIGSF
C0PRE4_______________FPGPLVNLTTN-WNAAVNVMNNLDEPLLITWNGLQNRRNSWQDGVSGTNCPIPVGWNWTYNFQAKDQIGSF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
