UniGene Name: sp_v3.0_unigene70411
Length: 207 nt
![]() |
---|
>sp_v3.0_unigene70411
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Chromatin-remodeling factor CHD3 n=5 Tax=Oryza sativa RepID=Q5SML0_ORYSJ | - | - | 7.0e-24 | 86% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 42% |
Sma3 | SNF2 family chromodomain-helicase | - | - | 4.19e-08 | - |
Source | Gene names |
---|---|
Sma3 | AT4g31900; At2g25170; At4g31900; CHR1504; CHR1512; CHR1519; CHR1536; CHR909; CHR911; F13D4.130; GSVIVT00032703001; GYM; OSJNBb0036B04.22; Os06g0183800; OsI_21929; OsJ_20361; P0554A06.6; PHATRDRAFT_13093; PHYPADRAFT_120666; PHYPADRAFT_145844; PHYPADRAFT_16 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SNF2-related | IPR000330 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | Rubredoxin-type fold | IPR004039 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1086 | IPR009462 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1087 | IPR009463 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - | |
Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G31900.1 | PKR2 chromatin remodeling factor, putative chr4:15431528-15438443 FORWARD LENGTH=1202 | 5.0e-27 | 78% |
RefSeq | Arabidopsis thaliana | NP_001190884.1 | putative chromatin remodeling factor [Arabidopsis thaliana] | 6.0e-27 | 78% |
RefSeq | Populus trichocarpa | XP_002324903.1 | chromatin remodeling complex subunit, partial [Populus trichocarpa] | 2.0e-27 | 78% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AD70
Fln msg: Distance to subject end: 181 aas, your sequence is shorter than subject: 68 - 377
Fln protein:
V
Protein Length:
69
Fln nts:
C
Fln Alignment:
GG46A6U02J4AHO___LKDQGHRVLIYSQFQHMLDILEDYLSYKHWNYERIDGKISGVERQIRIDRFNAPNS
D5AD70_______________LRARNHKVLIFSQWTRVLDLLDYCLSESGHDMCRIDGSVKLHDRQRQIKDFNDPNS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain