SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene70399

Length: 285 nt

UniGene Fasta

>sp_v3.0_unigene70399
CGTCGTGACCTTGGCTGTCACTCATTTCTTCATTCAATTGTAGATCCATCTGTTGGGGAAGATCTCCATGGCTACCAGAGACGGACAAGGCGATGTTAATCACGAGAGAGGCAATGCTAATTCCGCCAAGGAAGTGCATTACAGAGGCGTGAGAAAAAGGCCGTGGGGTCGATACGCCGCAGAGATCAGAGACCCCTTGAGTAAAAAACGCTTGTGGCTCGGAACTTTCGATACCGGCGAGGAGGCAGCCAAAGAATACGACAAAGCCGCCAGATATTTGAGAGG

Ace file of the UniGene sp_v3.0_unigene70399

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Ethylene-responsive transcription factor 4 n=4 Tax=Nicotiana RepID=ERF4_NICSY	-	-	2.0e-19	62%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	62%
Sma3	AP2/ERF domain-containing transcription factor	-	-	0.0	-

Source	Gene names
Sma3	26.t00057; AT1G53910; ATF2; At1g03800; At1g12980; At1g24590; At1g28160; At1g28360; At1g28370; At1g50640; At1g53170; At1g53910; At2g33710; At3g15210; At3g20310; At3g61630; At5g13910; At5g44210; At5g51190; B0811B10.20; B1103G11.12; BIERF2; CGLD5A; CGLD5B; C

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	nucleolus	GO:0005730	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	plastid	GO:0009536	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	nuclear body	GO:0016604	Cellular Component	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	transcription repressor activity	GO:0016564	Molecular Function	-
Sma3	hydrolase activity	GO:0016787	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	response to water deprivation	GO:0009414	Biological Process	-
Sma3	response to auxin stimulus	GO:0009733	Biological Process	-
Sma3	auxin mediated signaling pathway	GO:0009734	Biological Process	-
Sma3	cytokinin mediated signaling pathway	GO:0009736	Biological Process	-
Sma3	response to abscisic acid stimulus	GO:0009737	Biological Process	-
Sma3	gibberellic acid mediated signaling pathway	GO:0009740	Biological Process	-
Sma3	induced systemic resistance, jasmonic acid mediated signaling pathway	GO:0009864	Biological Process	-
Sma3	ethylene mediated signaling pathway	GO:0009873	Biological Process	-
Sma3	embryonic pattern specification	GO:0009880	Biological Process	-
Sma3	positive regulation of seed germination	GO:0010030	Biological Process	-
Sma3	specification of organ axis polarity	GO:0010084	Biological Process	-
Sma3	negative regulation of ethylene mediated signaling pathway	GO:0010105	Biological Process	-
Sma3	response to chitin	GO:0010200	Biological Process	-
Sma3	transcription factor import into nucleus	GO:0042991	Biological Process	-
Sma3	leaf development	GO:0048366	Biological Process	-
Sma3	cotyledon development	GO:0048825	Biological Process	-
Sma3	regulation of cell cycle	GO:0051726	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	NUDIX hydrolase domain	IPR000086	-	-
Sma3	AP2/ERF domain	IPR001471	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	DNA ligase, ATP-dependent, conserved site	IPR016059	-	-
Sma3	Chaperonin Cpn60, conserved site	IPR018370	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G28360.1	ERF12, ATERF12 ERF domain protein 12 chr1:9951934-9952503 FORWARD LENGTH=189	1.0e-24	81%
RefSeq	Arabidopsis thaliana	NP_174158.1	ethylene-responsive transcription factor 12 [Arabidopsis thaliana]	2.0e-24	81%
RefSeq	Populus trichocarpa	XP_002327909.1	AP2/ERF domain-containing transcription factor [Populus trichocarpa]	9.0e-25	82%

Full-Lengther Next Prediction

Fln status: Putative N-terminus

Fln database: coniferopsida.fasta

Fln subject: A9NMP1

Fln msg: Distance to subject end: 135 aas, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 72 - 225

Fln protein: MATRDGQGDVNHERGNANSAKEVHYRGVRKRPWGRYAAEIRDPLSKKRLWLGTFDTGEEAAKEYDKAARYLR

Protein Length: 73

Fln nts: CGTCGTGACCTTGGCTGTCACTCATTTCTTCATTCAATTGTAGATCCATCTGTTGGGGAAGATCTCC_-_ATGGCTACCAGAGACGGACAAGGCGATGTTAATCACGAGAGAGGCAATGCTAATTCCGCCAAGGAAGTGCATTACAGAGGCGTGAGAAAAAGGCCGTGGGGTCGATACGCCGCAGAGATCAGAGACCCCTTGAGTAAAAAACGCTTGTGGCTCGGAACTTTCGATACCGGCGAGGAGGCAGCCAAAGAATACGACAAAGCCGCCAGATATTTGAGAGG

Fln Alignment:

GG46A6U02JY5QF___ISMATRDGQGDVNHERGNANSA-KEVHYRGVRKRPWGRYAAEIRDPLSKKRLWLGTFDTGEEAAKEYDKAARYLR
A9NMP1_______________MQMARMEMKRDIGVCEVEASSAVKETHFRGVRKRPWGRFAAEIRDPLKKTRVWLGTFDTAEEAARAYDNAARNLR

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain