UniGene Name: sp_v3.0_unigene70394
Length: 198 nt
UniGene Fasta |
---|
>sp_v3.0_unigene70394
C |
Ace file of the UniGene sp_v3.0_unigene70394 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Tubulin beta chain, putative n=1 Tax=Ricinus communis RepID=B9SB77_RICCO | - | - | 3.0e-20 | 89% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
Sma3 | Beta tubulin like protein | - | - | 3.208e-08 | - |
Source | Gene names |
---|---|
Sma3 | AT4G20890; At1g20010; At1g75780/T4O12_29; At2g29550; At4g20890; At5g12250; At5g12250/MXC9_21; At5g23860; At5g62690; BTub-1; BTub1; BTub4; F16P2.7; GSVIVT00000394001; GSVIVT00000417001; GSVIVT00009147001; GSVIVT00014415001; GSVIVT00017326001; GSVIVT0001782 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | microtubule | GO:0005874 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
Sma3 | structural molecule activity | GO:0005198 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | microtubule-based movement | GO:0007018 | Biological Process | 0.0 | - |
Sma3 | protein polymerization | GO:0051258 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Tubulin | IPR000217 | - | 0.0 | - |
Sma3 | Beta tubulin | IPR002453 | - | 0.0 | - |
Sma3 | Tubulin/FtsZ, GTPase domain | IPR003008 | - | 0.0 | - |
Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
Sma3 | Tubulin, conserved site | IPR017975 | - | 0.0 | - |
Sma3 | Tubulin/FtsZ, 2-layer sandwich domain | IPR018316 | - | 0.0 | - |
Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G12250.1 | TUB6 beta-6 tubulin chr5:3961317-3962971 REVERSE LENGTH=449 | 1.0e-25 | 87% |
RefSeq | Arabidopsis thaliana | NP_196786.1 | tubulin beta-6 chain [Arabidopsis thaliana] | 2.0e-25 | 87% |
RefSeq | Populus trichocarpa | XP_002336980.1 | tubulin, beta chain, partial [Populus trichocarpa] | 8.0e-28 | 87% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PT51
Fln msg: Distance to subject end: 37 aas, your sequence is shorter than subject: 65 - 444
Fln protein:
V
Protein Length:
66
Fln nts:
C
Fln Alignment:
GG46A6U02GIC0E___QSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLLFGYTGQGMDEM
C0PT51_______________KSSVCDIPPRGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHW-YTGEGMDEM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain