UniGene Name: sp_v3.0_unigene70181
Length: 168 nt
![]() |
---|
>sp_v3.0_unigene70181
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Senescence-associated cysteine protease n=3 Tax=Brassica RepID=Q8W180_BRAOL | - | - | 5.0e-16 | 77% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
Sma3 | Cysteine proteinase | - | - | 4.221e-37 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 3.081e-09 | - |
Sma3 | Hydrolases, Acting on peptide bonds (peptide hydrolases), Cysteine endopeptidases. | EC:3.4.22.- | - | 2.555e-22 | - |
Source | Gene names |
---|---|
Sma3 | At1g09850; At1g20850; At1g47128; At3g19390; At3g19400; At3g19400/MLD14.12; At4g35350; At4g36880; At5g43060; At5g43060/MMG4.7; BoCP3; BrCP3; C14; C7A10.480; CEP1; CEP2; CHLREDRAFT_155869; CHLREDRAFT_206048; CP1; CP2; CP3; CP7; CPRF; CPRZ; DC-CP2; DCCP1; Dc |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | cysteine-type endopeptidase activity | GO:0004197 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | developmental programmed cell death | GO:0010623 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Anaphylatoxin/fibulin | IPR000020 | - | 0.0 | - |
Sma3 | Granulin | IPR000118 | - | 0.0 | - |
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Peptidase C1A, papain C-terminal | IPR000668 | - | 0.0 | - |
Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
Sma3 | Mannose-binding lectin | IPR001229 | - | 0.0 | - |
Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Phospholipase A2, active site | IPR013090 | - | 0.0 | - |
Sma3 | Peptidase C1A, papain | IPR013128 | - | 0.0 | - |
Sma3 | Proteinase inhibitor I29, cathepsin propeptide | IPR013201 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | IPR018069 | - | 0.0 | - | |
Sma3 | Heat shock protein DnaJ, conserved site | IPR018253 | - | 0.0 | - |
Sma3 | Ribosomal protein L29, conserved site | IPR018254 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G47128.1 | RD21, RD21A Granulin repeat cysteine protease family protein chr1:17283139-17285609 REVERSE LENGTH=462 | 2.0e-21 | 75% |
RefSeq | Arabidopsis thaliana | NP_564497.1 | cysteine proteinase RD21a [Arabidopsis thaliana] | 2.0e-21 | 75% |
RefSeq | Populus trichocarpa | XP_002326950.1 | predicted protein [Populus trichocarpa] | 5.0e-20 | 75% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW12
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 74 aas, your sequence is shorter than subject: 55 - 294
Fln protein:
S
Protein Length:
56
Fln nts:
C
Fln Alignment:
GG46A6U02HF2Z5___ISEQELCDCDTSYNNGCDGGLMDYAFQWVIMNGGIDTEVDYPYKGVQK
A9NW12_______________LSEQELCDCDTSYNSGCDGGLMDYAFQWVIVNGGIDTEVDYPYKGVQK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain