UniGene Name: sp_v3.0_unigene70120
Length: 210 nt
UniGene Fasta |
---|
>sp_v3.0_unigene70120
T |
Ace file of the UniGene sp_v3.0_unigene70120 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative receptor serine/threonine kinase PR5K [Oryza sativa Japonica Group] | - | - | 7.0e-15 | 61% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 49% |
Sma3 | Chromosome chr16 scaffold_86, whole genome shotgun sequence | - | - | 7.01e-16 | - |
Source | Gene names |
---|---|
Sma3 | 8ARK2; B1423D04.25; GSVIVT00000338001; GSVIVT00004127001; GSVIVT00004129001; GSVIVT00004243001; GSVIVT00004707001; GSVIVT00004959001; GSVIVT00005129001; GSVIVT00005131001; GSVIVT00005229001; GSVIVT00005232001; GSVIVT00006441001; GSVIVT00007886001; GSVIVT0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Ribonuclease T2, active site | IPR018188 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G66920.2 | Protein kinase superfamily protein chr1:24965410-24967432 REVERSE LENGTH=617 | 7.0e-18 | 59% |
RefSeq | Arabidopsis thaliana | NP_176864.1 | protein kinase-like protein [Arabidopsis thaliana] | 9.0e-18 | 59% |
RefSeq | Populus trichocarpa | XP_002334500.1 | predicted protein [Populus trichocarpa] | 4.0e-18 | 61% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQB9
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 195 aas, your sequence is shorter than subject: 68 - 290
Fln protein:
T
Protein Length:
69
Fln nts:
T
Fln Alignment:
GG46A6U02FF35I___LVYEYMANGSLDKFIFAGKDKRQVLMWEQLYSIALGAARGIAYLHHDCDKRIIHFDIKTSQYI
A9NQB9_______________LVYEYLPNKSLDKLLF-NPERRKVLDWQKRYNIIIGVARGLLYLHQDSQLRIIHRDVKVNNIL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain