UniGene Name: sp_v3.0_unigene70096
Length: 199 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene70096
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Reverse transcriptase n=1 Tax=Picea glauca RepID=Q9M5J7_PICGL | - | - | 3.0e-14 | 79% |
FL-Next | tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 79% |
Source | Gene names |
---|---|
Sma3 | VITISV_000081; VITISV_000540; VITISV_001087; VITISV_001135; VITISV_001479; VITISV_001508; VITISV_001707; VITISV_001876; VITISV_003755; VITISV_003773; VITISV_003855; VITISV_003944; VITISV_004379; VITISV_004415; VITISV_005765; VITISV_005778; VITISV_006366; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | phosphopyruvate hydratase complex | GO:0000015 | Cellular Component | 0.0 | - |
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | dihydrofolate reductase activity | GO:0004146 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | phosphopyruvate hydratase activity | GO:0004634 | Molecular Function | 0.0 | - |
Sma3 | ionotropic glutamate receptor activity | GO:0004970 | Molecular Function | 0.0 | - |
Sma3 | extracellular-glutamate-gated ion channel activity | GO:0005234 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | nutrient reservoir activity | GO:0045735 | Molecular Function | 0.0 | - |
Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | glycine biosynthetic process | GO:0006545 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | nucleotide biosynthetic process | GO:0009165 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | transposition | GO:0032196 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Enolase | IPR000941 | - | 0.0 | - |
Sma3 | Ionotropic glutamate receptor | IPR001320 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Dihydrofolate reductase domain | IPR001796 | - | 0.0 | - |
Sma3 | Pleckstrin homology domain | IPR001849 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Germin | IPR001929 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
Sma3 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR003583 | - | 0.0 | - |
Sma3 | Cupin 1 | IPR006045 | - | 0.0 | - |
Sma3 | Dihydrofolate reductase | IPR012259 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | RmlC-like jelly roll fold | IPR014710 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | Peptidase A2A, retrovirus RVP subgroup | IPR018061 | - | 0.0 | - |
Sma3 | Germin, manganese binding site | IPR019780 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9M5J7
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 129 aas, your sequence is shorter than subject: 65 - 542
Fln protein:
C
Protein Length:
66
Fln nts:
G
Fln Alignment:
GG46A6U02IJUEW___QCPKT*EEEEDMPHVPYASVFSSLMYAMVCTRTNIAHAVGVLSRFMSKL
Q9M5J7_______________QCPKIQEEEEDMSHVPYASAVGSLMYAMVCTRPDIAHAVGFLSRYMSKL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain