UniGene Name: sp_v3.0_unigene69762
Length: 243 nt
![]() |
---|
>sp_v3.0_unigene69762
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Flavonol synthase n=2 Tax=Camellia sinensis RepID=A2TJG2_CAMSI | - | - | 7.0e-23 | 78% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
Sma3 | Anthocyanidin synthase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Leucocyanidin oxygenase. | EC:1.14.11.19 | - | 1.155e-19 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavonoid biosynthesis | 00941 | 1.155e-19 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.155e-19 | % | |
Sma3 | Metabolic pathways | 01100 | 1.155e-19 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.155e-19 | % | |
Sma3 | Flavonol synthase. | EC:1.14.11.23 | - | 6.446e-23 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavonoid biosynthesis | 00941 | 6.446e-23 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 6.446e-23 | % | |
Sma3 | Metabolic pathways | 01100 | 6.446e-23 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 6.446e-23 | % | |
Sma3 | Flavanone 3-dioxygenase. | EC:1.14.11.9 | - | 5.809e-13 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavonoid biosynthesis | 00941 | 5.809e-13 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 5.809e-13 | % | |
Sma3 | Metabolic pathways | 01100 | 5.809e-13 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 5.809e-13 | % |
Source | Gene names |
---|---|
Sma3 | ANS; ANS-FL1; ANS1; ANS2; ANS3; ANT17; AT4G22880; Ans2; At4g22880; CtANS6; CtFLS; EgANS; EgFLS; F7H19.60; FL; FLS; FLS1; FLS2; FLS3; FLS4; FLS5; FLS6; FS; GSVIVT00001063001; GSVIVT00015339001; GSVIVT00015340001; GSVIVT00015342001; GSVIVT00015343001; GSVIV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
Sma3 | L-ascorbic acid binding | GO:0031418 | Molecular Function | 0.0 | - |
Sma3 | flavonol synthase activity | GO:0045431 | Molecular Function | 0.0 | - |
Sma3 | naringenin 3-dioxygenase activity | GO:0045486 | Molecular Function | 0.0 | - |
Sma3 | leucocyanidin oxygenase activity | GO:0050589 | Molecular Function | 0.0 | - |
Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ArgE/DapE/ACY1/CPG2/YscS, conserved site | IPR001261 | - | 0.0 | - |
Sma3 | Isopenicillin N synthase | IPR002283 | - | 0.0 | - |
Sma3 | Oxoglutarate/iron-dependent oxygenase | IPR005123 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G08640.1 | FLS, ATFLS1, FLS1 flavonol synthase 1 chr5:2804009-2805175 FORWARD LENGTH=336 | 6.0e-22 | 72% |
RefSeq | Arabidopsis thaliana | NP_001190266.1 | flavonol synthase/flavanone 3-hydroxylase [Arabidopsis thaliana] | 7.0e-22 | 72% |
RefSeq | Populus trichocarpa | XP_002330443.1 | flavonol synthase 3 [Populus trichocarpa] | 3.0e-23 | 68% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P180
Fln msg: Overlapping hits, possible frame ERROR between 178 and 174, Distance to subject end: 78 aas, your sequence is shorter than subject: 81 - 345
Fln protein:
V
Protein Length:
82
Fln nts:
C
Fln Alignment:
GG46A6U01B52ZH___GENLEMEMKINYYPPCPQPELALGVEPHTDMSALTLLIPNEVPGLQVF-xxxxVSSTYIPNAIIVHIGDQLE
A9P180_______________GENLEMELKINFYPPCPQPEMALGVLPHTDLCALTVLKPNDVPGLQIFKxxxxVTAKYVPNTLIIHIGDQLQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain