UniGene Name: sp_v3.0_unigene69721
Length: 218 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene69721
C |
Ace file of the UniGene sp_v3.0_unigene69721
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | auxin response factor 10 [Arabidopsis thaliana] | - | - | 8.0e-09 | 76% |
| FL-Next | sp=Auxin response factor 10; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 76% |
| Sma3 | Auxin response factor, putative | - | - | 1.42e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | ARF10; ARF16; ARF18; ARF22; ARF3; At2g28350; At4g30080; F6G3.110; GSVIVT00018183001; GSVIVT00023198001; GSVIVT00024547001; LOC_Os06g47150; LOC_Os10g33940; MtrDRAFT_AC148995g33v2; MtrDRAFT_AC148995g9v2; OSIGBa0145G11.4; OSJNBa0093B11.2; Os06g0685700; Os10g |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
| Sma3 | response to hormone stimulus | GO:0009725 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | response to carbohydrate stimulus | GO:0009743 | Biological Process | 0.0 | - |
| Sma3 | fruit development | GO:0010154 | Biological Process | 0.0 | - |
| Sma3 | regulation of anthocyanin biosynthetic process | GO:0031540 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Sma3 | petal development | GO:0048441 | Biological Process | 0.0 | - |
| Sma3 | sepal development | GO:0048442 | Biological Process | 0.0 | - |
| Sma3 | developmental growth | GO:0048589 | Biological Process | 0.0 | - |
| Sma3 | root cap development | GO:0048829 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | B3 DNA binding domain | IPR003340 | - | 0.0 | - |
| Sma3 | Auxin response factor | IPR010525 | - | 0.0 | - |
| Sma3 | Aux/IAA-ARF-dimerisation | IPR011525 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G28350.1 | ARF10 auxin response factor 10 chr2:12114331-12116665 FORWARD LENGTH=693 | 2.0e-12 | 76% |
| RefSeq | Arabidopsis thaliana | NP_180402.1 | auxin response factor 10 [Arabidopsis thaliana] | 2.0e-12 | 76% |
| RefSeq | Populus trichocarpa | XP_002323468.1 | predicted protein [Populus trichocarpa] | 4.0e-15 | 78% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SKN5
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 555 aas, your sequence is shorter than subject: 72 - 693
Fln protein:
V
Protein Length:
73
Fln nts:
C
Fln Alignment:
GG46A6U01AQ5GH___SQTETANNNHPPASFAKTLTQSDANNGGGFSVPRYCAE
Q9SKN5_______________SSDGNGNGKEKPASFAKTLTQSDANNGGGFSVPRYCAE

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta