|
||||||
|
UniGene Name: sp_v3.0_unigene69716
Length: 203 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene69716
C |
|
Ace file of the UniGene sp_v3.0_unigene69716
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 50% |
| Source | Gene names |
|---|---|
| Sma3 | SDM1_42t00010; SDM1_46t00012; VITISV_000113; VITISV_001619; VITISV_001841; VITISV_002222; VITISV_002746; VITISV_002882; VITISV_002891; VITISV_003323; VITISV_003442; VITISV_003815; VITISV_005690; VITISV_006017; VITISV_007430; VITISV_007625; VITISV_008342; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | alpha-mannosidase activity | GO:0004559 | Molecular Function | 0.0 | - |
| Sma3 | triglyceride lipase activity | GO:0004806 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
| Sma3 | mannose metabolic process | GO:0006013 | Biological Process | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9M5J7
Fln msg: Distance to subject end: 36 aas, your sequence is shorter than subject: 67 - 542
Fln protein:
R
Protein Length:
68
Fln nts:
C
Fln Alignment:
GG46A6U01DBXT9___WAGSSVDRKSTSGYCFNVGSGMISWCSKKRKSVALSSTEAEYMAASTTTCEAIWHRKL
Q9M5J7_______________WVGDLDHIRSTSGYVFNLFGGAISWMSKIQALVALSTTEAEYMVATHASQGSIWLQRL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
