UniGene Name: sp_v3.0_unigene69708
Length: 182 nt
![]() |
---|
>sp_v3.0_unigene69708
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative n=1 Tax=Ricinus communis RepID=B9T5Y1_RICCO | - | - | 3.0e-20 | 83% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
Sma3 | Phospholipase C | - | - | 8.732e-32 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoinositide phospholipase C. | EC:3.1.4.11 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Inositol phosphate metabolism | 00562 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Phosphatidylinositol signaling system | 04070 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | 56B23-g7; 56B23-g8; AT3G08510; AT5G58700; ATHATPLC5; ATHATPLC6; At2g40116; At3g08510; At3g55940; At5g58690; At5g58700; F27K19.120; GSVIVT00021509001; GSVIVT00024092001; GSVIVT00024093001; GSVIVT00024094001; GSVIVT00029293001; GSVIVT00038892001; LOC_Os03g1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | phosphatidylinositol phospholipase C activity | GO:0004435 | Molecular Function | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | phosphatidylcholine phospholipase C activity | GO:0034480 | Molecular Function | 0.0 | - |
Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
Sma3 | lipid catabolic process | GO:0016042 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
Sma3 | Phospholipase C, phosphatidylinositol-specific , X domain | IPR000909 | - | 0.0 | - |
Sma3 | Phosphoinositide phospholipase C | IPR001192 | - | 0.0 | - |
Sma3 | Phospholipase C, phosphatidylinositol-specific, Y domain | IPR001711 | - | 0.0 | - |
Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
Sma3 | Phospholipase C, phosphoinositol-specific, EF-hand-like | IPR015359 | - | 0.0 | - |
Sma3 | PLC-like phosphodiesterase, TIM beta/alpha-barrel domain | IPR017946 | - | 0.0 | - |
Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
Sma3 | Integrin alpha chain, C-terminal cytoplasmic region, conserved site | IPR018184 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G55940.1 | Phosphoinositide-specific phospholipase C family protein chr3:20747787-20750184 FORWARD LENGTH=584 | 4.0e-25 | 81% |
RefSeq | Arabidopsis thaliana | NP_191153.1 | phosphoinositide phospholipase C 7 [Arabidopsis thaliana] | 5.0e-25 | 81% |
RefSeq | Populus trichocarpa | XP_002311223.1 | predicted protein [Populus trichocarpa] | 5.0e-26 | 83% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLW1
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 45 aas, your sequence is shorter than subject: 60 - 597
Fln protein:
S
Protein Length:
61
Fln nts:
C
Fln Alignment:
GG46A6U01D15P9___RVGIAGVPADTIMKKTRTIEDDWVPCWNEDFVFPLSVPELALLRIEVHEYDMS
B8LLW1_______________RVGIAGVPADTIMKRTRAIEDDWFPCWNEEFVFPLTVPELAVLRVEVHEYDMS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain