|
||||||
|
UniGene Name: sp_v3.0_unigene69688
Length: 215 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene69688
C |
|
Ace file of the UniGene sp_v3.0_unigene69688
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phospholipase D n=2 Tax=Populus trichocarpa RepID=B9GH43_POPTR | - | - | 6.0e-24 | 83% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
| Sma3 | Phospholipase D alpha 1 | - | - | 4.073e-30 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phospholipase D. | EC:3.1.4.4 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycerophospholipid metabolism | 00564 | 0.0 | % | |
| Sma3 | Ether lipid metabolism | 00565 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g52570; At3g15730; At5g25370; F18G18.110; F6D8.21; GSVIVT00000347001; GSVIVT00016906001; GSVIVT00032653001; LOC_Os01g07760; LOC_Os03g02740; LOC_Os03g27370; LOC_Os06g40190; LOC_Os10g38060; MSJ11.13; MtrDRAFT_AC149206g21v2; OJ1263H11.7; OJ1740_D06.16; OS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | clathrin-coated vesicle | GO:0030136 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasmic vesicle | GO:0031410 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | phospholipase D activity | GO:0004630 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | NAPE-specific phospholipase D activity | GO:0070290 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid metabolic process | GO:0006631 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of abscisic acid mediated signaling pathway | GO:0009789 | Biological Process | 0.0 | - |
| Sma3 | seed germination | GO:0009845 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
| Sma3 | lipid catabolic process | GO:0016042 | Biological Process | 0.0 | - |
| Sma3 | membrane lipid catabolic process | GO:0046466 | Biological Process | 0.0 | - |
| Sma3 | phosphatidylcholine metabolic process | GO:0046470 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Phospholipase D/Transphosphatidylase | IPR001736 | - | 0.0 | - |
| Sma3 | YLP motif | IPR004019 | - | 0.0 | - |
| Sma3 | Phospholipase D, plant | IPR011402 | - | 0.0 | - |
| Sma3 | Phospholipase D | IPR015679 | - | 0.0 | - |
| Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G52570.1 | PLDALPHA2 phospholipase D alpha 2 chr1:19583940-19586551 REVERSE LENGTH=810 | 6.0e-26 | 76% |
| RefSeq | Arabidopsis thaliana | NP_175666.1 | phospholipase D alpha 2 [Arabidopsis thaliana] | 8.0e-26 | 76% |
| RefSeq | Populus trichocarpa | XP_002299756.1 | predicted protein [Populus trichocarpa] | 3.0e-30 | 83% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NV59
Fln msg: Distance to subject end: 291 aas, your sequence is shorter than subject: 71 - 482
Fln protein:
R
Protein Length:
72
Fln nts:
C
Fln Alignment:
GG46A6U01CQ8U4___HSNDVESWNVQVFRSIDGGAAFGFPERPEEAAKAGLVSGKDVIVDRSIQDAYINAIRRANNFIYI
A9NV59_______________YEDDQETWNVQVFRSIDGGAAFGFPETPEDAARSGLVSGKDNIIDRSIQDAYINAIRRAKDFIYI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
