UniGene Name: sp_v3.0_unigene69676
Length: 162 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene69676
C |
Ace file of the UniGene sp_v3.0_unigene69676
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | F10B6.22 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KCK0_ARALL | - | - | 2.0e-08 | 81% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 83% |
| Sma3 | Aspartate semialdehyde dehydrogenase | - | - | 4.107e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aspartate-semialdehyde dehydrogenase. | EC:1.2.1.11 | - | 1.232e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycine, serine and threonine metabolism | 00260 | 1.232e-08 | % | |
| Sma3 | Cysteine and methionine metabolism | 00270 | 1.232e-08 | % | |
| Sma3 | Lysine biosynthesis | 00300 | 1.232e-08 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 1.232e-08 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 1.232e-08 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.232e-08 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.232e-08 | % |
| Source | Gene names |
|---|---|
| Sma3 | ASDH; ASSD1; At1g14810; CHLREDRAFT_148810; GSVIVT00030599001; LOC_Os03g55280; OSJNBb0048A17.6; Os03g0760700; OsI_13624; OsJ_12673; PHYPADRAFT_147643; POPTRDRAFT_564677; POPTRDRAFT_566429; POPTRDRAFT_591327; RCOM_0053530; VITISV_041291; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | aspartate-semialdehyde dehydrogenase activity | GO:0004073 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor | GO:0016620 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
| Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
| Sma3 | cellular amino acid biosynthetic process | GO:0008652 | Biological Process | 0.0 | - |
| Sma3 | methionine biosynthetic process | GO:0009086 | Biological Process | 0.0 | - |
| Sma3 | threonine biosynthetic process | GO:0009088 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Semialdehyde dehydrogenase, NAD-binding | IPR000534 | - | 0.0 | - |
| Sma3 | CRAL-TRIO domain | IPR001251 | - | 0.0 | - |
| Sma3 | Aspartate-semialdehyde dehydrogenase, beta-type | IPR005986 | - | 0.0 | - |
| Sma3 | Aspartate-semialdehyde dehydrogenase | IPR012080 | - | 0.0 | - |
| Sma3 | Semialdehyde dehydrogenase, dimerisation domain | IPR012280 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G14810.1 | semialdehyde dehydrogenase family protein chr1:5102684-5104633 REVERSE LENGTH=375 | 3.0e-12 | 78% |
| RefSeq | Arabidopsis thaliana | NP_172934.1 | semialdehyde dehydrogenase-like protein [Arabidopsis thaliana] | 4.0e-12 | 78% |
| RefSeq | Populus trichocarpa | XP_002311534.1 | predicted protein [Populus trichocarpa] | 9.0e-12 | 78% |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5A9F9
Fln msg: your sequence is shorter than subject: 38 - 397
Fln protein:
R
Protein Length:
39
Fln nts:
C
Fln Alignment:
GG46A6U01CNRZ5___RRDLGCHSDYGLDIFVCGDQIRKGAALNAVQIAERLL
D5A9F9_______________RQDASQNGDYGLDIFVCGDQIRKGAALNAVQIAERLL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta