|
||||||
|
UniGene Name: sp_v3.0_unigene69661
Length: 190 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene69661
C |
|
Ace file of the UniGene sp_v3.0_unigene69661
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Class II chitinase 2-1 n=1 Tax=Pseudotsuga menziesii RepID=D7P704_PSEMZ | - | - | 9.0e-21 | 80% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
| Sma3 | Class IV chitinase | - | - | 8.662e-29 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Chitinase. | EC:3.2.1.14 | - | 8.176e-26 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 8.176e-26 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g43590; At3g54420; BNCHITIN-1; BNCHITIN-2; BNCHITIN-BO-1; BNCHITIN-BR-1; Bcchi; CHB4; CHIV; Ch4; Chi; Chi4C; Chi4D; Cht; Cht4; GSVIVT00034623001; GSVIVT00034626001; GSVIVT00034628001; GSVIVT00034631001; GSVIVT00034632001; GSVIVT00034634001; GSVIVT00034 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | chitinase activity | GO:0004568 | Molecular Function | 0.0 | - |
| Sma3 | chitin binding | GO:0008061 | Molecular Function | 0.0 | - |
| Sma3 | chitin catabolic process | GO:0006032 | Biological Process | 0.0 | - |
| Sma3 | cell wall macromolecule catabolic process | GO:0016998 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 19, catalytic | IPR000726 | - | 0.0 | - |
| Sma3 | Chitin-binding, type 1 | IPR001002 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 19 | IPR016283 | - | 0.0 | - |
| Sma3 | Chitin-binding, type 1, conserved site | IPR018371 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G43590.1 | Chitinase family protein chr2:18081592-18082749 REVERSE LENGTH=264 | 4.0e-23 | 68% |
| RefSeq | Arabidopsis thaliana | NP_181887.1 | chitinase-like protein [Arabidopsis thaliana] | 5.0e-23 | 68% |
| RefSeq | Populus trichocarpa | XP_002326041.1 | predicted protein [Populus trichocarpa] | 1.0e-23 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NP79
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 91 aas, your sequence is shorter than subject: 62 - 229
Fln protein:
S
Protein Length:
63
Fln nts:
C
Fln Alignment:
GG46A6U01CSIN0___FFANAAHLTGDFCYIEHINKSDYCDSTNTQYPCATGKQYYGRGPMQLSWNYNYG
A9NP79_______________FFANVAHETGSLCYVEEINKSDYCDSTNTQYPCVAGKQYYGRGPLQLTWNYNYG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
