UniGene Name: sp_v3.0_unigene69660
Length: 219 nt
![]() |
---|
>sp_v3.0_unigene69660
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cytochrome P450, putative n=1 Tax=Ricinus communis RepID=B9RHG4_RICCO | - | - | 2.0e-11 | 66% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
Sma3 | Chromosome chr18 scaffold_24, whole genome shotgun sequence | - | - | 3.178e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Taxane 13-alpha-hydroxylase. | EC:1.14.13.77 | - | 2.714e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Diterpenoid biosynthesis | 00904 | 2.714e-06 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 2.714e-06 | % | |
Sma3 | Metabolic pathways | 01100 | 2.714e-06 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.714e-06 | % |
Source | Gene names |
---|---|
Sma3 | At5g36130; CYP716A3; CYP716B1; CYP716B2; GSVIVT00008991001; GSVIVT00016986001; GSVIVT00021946001; GSVIVT00021947001; GSVIVT00021949001; GSVIVT00021981001; GSVIVT00021982001; GSVIVT00031766001; GSVIVT00032382001; POPTRDRAFT_592301; POPTRDRAFT_736629; POPTR |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Cytochrome P450, B-class | IPR002397 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G36130.1 | Cytochrome P450 superfamily protein chr5:14209293-14209811 REVERSE LENGTH=140 | 7.0e-17 | 64% |
RefSeq | Arabidopsis thaliana | NP_198462.1 | Cytochrome P450 family protein [Arabidopsis thaliana] | 9.0e-17 | 64% |
RefSeq | Populus trichocarpa | XP_002324668.1 | cytochrome P450 [Populus trichocarpa] | 4.0e-16 | 68% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P257
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 41 aas, your sequence is shorter than subject: 73 - 327
Fln protein:
R
Protein Length:
74
Fln nts:
C
Fln Alignment:
GG46A6U01ETRSF___QMVWSVSSTHVTPEYFRDPEKFDPSRFEEAVPPPYTYVPFGGGLR
A9P257_______________KMYWTVNSTHRKSEYFSNPENFDPSRFEGAGPPPYTFVPFGGGPR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain