UniGene Name: sp_v3.0_unigene69654
Length: 195 nt
![]() |
---|
>sp_v3.0_unigene69654
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative polyprotein n=2 Tax=Oryza sativa Japonica Group RepID=Q60DI2_ORYSJ | - | - | 4.0e-15 | 63% |
FL-Next | tr=Putative gag-pol polyprotein; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 68% |
Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 2.626e-27 | - |
Source | Gene names |
---|---|
Sma3 | B1159F04.11; H0502G05.10; H0512B01.1; H0624F09.1; H0807C06-H0308C08.9; H0813E03.8; H0818H01.18; LOC_Os03g15160; LOC_Os03g23220; LOC_Os03g23800; LOC_Os03g23830; LOC_Os03g23840; LOC_Os03g23860; LOC_Os03g26750; LOC_Os03g32960; LOC_Os03g33140; LOC_Os03g36050; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | cytoskeleton organization | GO:0007010 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF834 | IPR008552 | - | 0.0 | - |
Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: Q6UU19
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 654 aas, your sequence is shorter than subject: 58 - 803
Fln protein:
R
Protein Length:
59
Fln nts:
C
Fln Alignment:
GG46A6U01BCHQO___YLDKFVIVFVDDILVYSTNEEDHAEHLAIVLRLLREN*LYANLSKCSFF*SEVHYVG
Q6UU19_______________YLDKFVVVFIDDILVYSQSEEDHQQHLRLVLRKLREHQLYAKLSKCEFWLSEVKFLG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain