UniGene Name: sp_v3.0_unigene69648
Length: 229 nt
![]() |
---|
>sp_v3.0_unigene69648
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Putative white-brown complex homolog protein 30; AltName: Full=Putative non-intrinsic ABC protein 12; AltName: Full=WBC-related protein 1 | - | - | 2.0e-21 | 72% |
FL-Next | sp=Putative white-brown complex homolog protein 30; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 72% |
Sma3 | White-brown-complex ABC transporter family | - | - | 1.592e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Xenobiotic-transporting ATPase. | EC:3.6.3.44 | - | 1.241e-07 | - |
Source | Gene names |
---|---|
Sma3 | At1g53390; At2g37010; At5g60740; B1206D04.17; F12M16.28; GSVIVT00018161001; GSVIVT00023219001; GSVIVT00024579001; LOC_Os10g30610; LOC_Os11g22350; MUP24.16; NAP12; OSJNBa0040D17.13; Os04g0194500; Os06g0731200; Os10g0442900; Os11g0416900; OsI_14980; OsI_245 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 5, conserved site | IPR018087 | - | 0.0 | - |
Sma3 | Sodium:dicarboxylate symporter, conserved site | IPR018107 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G37010.1 | ATNAP12, NAP12 non-intrinsic ABC protein 12 chr2:15541720-15546159 FORWARD LENGTH=1082 | 6.0e-27 | 72% |
RefSeq | Arabidopsis thaliana | NP_181238.4 | putative white-brown complex-protein 30 [Arabidopsis thaliana] | 8.0e-27 | 72% |
RefSeq | Populus trichocarpa | XP_002326363.1 | white-brown-complex ABC transporter family, partial [Populus trichocarpa] | 3.0e-28 | 75% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SJK6
Fln msg: Distance to subject end: 81 aas, your sequence is shorter than subject: 76 - 1082
Fln protein:
V
Protein Length:
77
Fln nts:
C
Fln Alignment:
GG46A6U01D1H6L___VIKPLVYLSMFYFFNNPRSTFAENYIVTLALVYCVVGIAYIFAIALDPGSAQLCSVLIPVVSTLIATQ
Q9SJK6_______________IMKPLVYLSMFYFFNNPRSSFEDNYIVLVCLVYCVTGMAYIFAILYSPSAAQLLSVLVPVVMTLIANQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain