UniGene Name: sp_v3.0_unigene69624
Length: 120 nt
![]() |
---|
>sp_v3.0_unigene69624
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Serine/threonine-protein phosphatase n=2 Tax=Selaginella moellendorffii RepID=D8SBH5_SELML | - | - | 3.0e-11 | 96% |
FL-Next | sp=Serine/threonine-protein phosphatase BSL2 homolog; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 96% |
Sma3 | Serine/threonine protein phosphatase | - | - | 4.559e-32 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoprotein phosphatase. | EC:3.1.3.16 | - | 3.539e-34 | - |
Source | Gene names |
---|---|
Sma3 | AT1G08420; At1g03445; At1g03450; At1g08420; At2g27210; At4g03080; BSL1; BSL2; BSL3; BSU1; CHLREDRAFT_101543; F21B7.7; GSVIVT00002635001; GSVIVT00007485001; GSVIVT00023616001; LOC_Os03g44500; LOC_Os05g05240; LOC_Os12g42310; M408G1.2f; MICPUCDRAFT_32951; MI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | phosphoprotein phosphatase activity | GO:0004721 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine phosphatase activity | GO:0004722 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | brassinosteroid mediated signaling pathway | GO:0009742 | Biological Process | 0.0 | - |
Sma3 | regulation of protein localization | GO:0032880 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
Sma3 | Metallophosphoesterase domain | IPR004843 | - | 0.0 | - |
Sma3 | Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase | IPR006186 | - | 0.0 | - |
Sma3 | Kelch repeat type 1 | IPR006652 | - | 0.0 | - |
Sma3 | Kelch repeat type 2 | IPR011498 | - | 0.0 | - |
Sma3 | Serine/threonine protein phosphatase, BSU1 | IPR012391 | - | 0.0 | - |
Sma3 | Kelch-type beta propeller | IPR015915 | - | 0.0 | - |
Sma3 | Galactose oxidase, beta-propeller | IPR015916 | - | 0.0 | - |
Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, conserved site | IPR018522 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G03080.1 | BSL1 BRI1 suppressor 1 (BSU1)-like 1 chr4:1359935-1365166 REVERSE LENGTH=881 | 1.0e-15 | 96% |
RefSeq | Arabidopsis thaliana | NP_192217.2 | serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana] | 2.0e-15 | 96% |
RefSeq | Populus trichocarpa | XP_002301559.1 | predicted protein [Populus trichocarpa] | 1.0e-15 | 96% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q2QM47
Fln msg: Distance to subject end: 269 aas, your sequence is shorter than subject: 40 - 1009
Fln protein:
R
Protein Length:
41
Fln nts:
C
Fln Alignment:
GG46A6U01CC294___FGDLHGQFGDLMRLFDEYGAPSTAGDITYIDY
Q2QM47_______________FGDLHGQFGDLMRLFDEYGAPSTAGDIAYIDY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain