UniGene Name: sp_v3.0_unigene69620
Length: 219 nt
UniGene Fasta |
---|
>sp_v3.0_unigene69620
C |
Ace file of the UniGene sp_v3.0_unigene69620 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative receptor-like protein kinase [Arabidopsis thaliana] sp|Q9FN92.1|Y5597_ARATH RecName: Full=Probable receptor-like protein kinase At5g59700; Flags: Precursor dbj|BAB09508.1| receptor-like protein kinase [Arabidopsis thaliana] gb|AED97221.1| putativ | - | - | 6.0e-14 | 64% |
FL-Next | sp=Probable receptor-like protein kinase At5g59700; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 64% |
Sma3 | FERONIA receptor-like kinase | - | - | 4.73e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 4.931e-06 | - |
Source | Gene names |
---|---|
Sma3 | AT4g39110; At2g21480; At3g04690; At3g46290; At3g51550; At4g39110; At5g28680; At5g54380; At5g59700; B1143G03.32; F12M12.260; F18L15.10; F19H22.210; F26O13.190; F7O18.16; FER; GSVIVT00016292001; GSVIVT00023386001; GSVIVT00036329001; GSVIVT00037712001; LOC_O |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Isopenicillin N synthase, conserved site | IPR002057 | - | 0.0 | - |
Sma3 | Peptidase S16, lon N-terminal | IPR003111 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G59700.1 | Protein kinase superfamily protein chr5:24052613-24055102 REVERSE LENGTH=829 | 2.0e-18 | 64% |
RefSeq | Arabidopsis thaliana | NP_200778.1 | putative receptor-like protein kinase [Arabidopsis thaliana] | 3.0e-18 | 64% |
RefSeq | Populus trichocarpa | XP_002313457.1 | predicted protein [Populus trichocarpa] | 4.0e-18 | 61% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9FN92
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 33 aas, your sequence is shorter than subject: 72 - 829
Fln protein:
S
Protein Length:
73
Fln nts:
C
Fln Alignment:
GG46A6U01C5XOJ___KCLADQGIDRPTMGDVLWNLEYALQLQETAMLDDPDENSANRISEIPLRFSQEEHFSSS
Q9FN92_______________KCLADYGVDRPSMGDVLWNLEYALQLQE-AVVDGDPEDSTNMIGELPLRFNDYNHGDTS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain