UniGene Name: sp_v3.0_unigene69619
Length: 218 nt
UniGene Fasta |
---|
>sp_v3.0_unigene69619
C |
Ace file of the UniGene sp_v3.0_unigene69619 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | AGO1-2 (Fragment) n=1 Tax=Nicotiana benthamiana RepID=Q2LFC3_NICBE | - | - | 8.0e-30 | 92% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Sma3 | Eukaryotic translation initiation factor 2c, putative | - | - | 2.663e-19 | - |
Source | Gene names |
---|---|
Sma3 | AGO1; AGO1505; AGO1507; AGO2; AGO3; AGO901; AGO904; AGO905; AGO906; AGO907; AGO909; AGO911; AGO915; At1g48410; At1g69440; At2g27880; At5g43810; CHLREDRAFT_18730; F10D13_11; GSVIVT00000553001; GSVIVT00000886001; GSVIVT00001880001; GSVIVT00005949001; GSVIVT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | endoribonuclease activity | GO:0004521 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | siRNA binding | GO:0035197 | Molecular Function | 0.0 | - |
Sma3 | miRNA binding | GO:0035198 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | virus induced gene silencing | GO:0009616 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | auxin metabolic process | GO:0009850 | Biological Process | 0.0 | - |
Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
Sma3 | vegetative phase change | GO:0010050 | Biological Process | 0.0 | - |
Sma3 | response to far red light | GO:0010218 | Biological Process | 0.0 | - |
Sma3 | production of ta-siRNAs involved in RNA interference | GO:0010267 | Biological Process | 0.0 | - |
Sma3 | production of lsiRNA involved in RNA interference | GO:0010599 | Biological Process | 0.0 | - |
Sma3 | RNA interference | GO:0016246 | Biological Process | 0.0 | - |
Sma3 | stem cell maintenance | GO:0019827 | Biological Process | 0.0 | - |
Sma3 | somatic stem cell maintenance | GO:0035019 | Biological Process | 0.0 | - |
Sma3 | gene silencing by miRNA | GO:0035195 | Biological Process | 0.0 | - |
Sma3 | regulation of development, heterochronic | GO:0040034 | Biological Process | 0.0 | - |
Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
Sma3 | adventitious root development | GO:0048830 | Biological Process | 0.0 | - |
Sma3 | stem cell development | GO:0048864 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ubiquitin | IPR000626 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
Sma3 | Stem cell self-renewal protein Piwi | IPR003165 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF221 | IPR003864 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1785 | IPR014811 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G48410.2 | - | 3.0e-36 | 90% |
RefSeq | Arabidopsis thaliana | NP_175274.1 | protein argonaute [Arabidopsis thaliana] | 4.0e-36 | 90% |
RefSeq | Populus trichocarpa | XP_002329692.1 | argonaute protein group [Populus trichocarpa] | 8.0e-37 | 90% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACK3
Fln msg: Distance to subject end: 53 aas, your sequence is shorter than subject: 72 - 229
Fln protein:
V
Protein Length:
73
Fln nts:
C
Fln Alignment:
GG46A6U01EK5LW___GIQGTSRPAHYHVLWDDNRFSADALQSLTNNLCYTYARCTRSISIVPPAYYAHLAAFRARFYVE
D5ACK3_______________GIQGTSRPAHYHVLWDENKFTADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYME
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain