|
||||||
|
UniGene Name: sp_v3.0_unigene69538
Length: 139 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene69538
C |
|
Ace file of the UniGene sp_v3.0_unigene69538
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pleiotropic drug resistance protein TUR2 n=1 Tax=Spirodela polyrhiza RepID=TUR2_SPIPO | - | - | 5.0e-08 | 76% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
| Sma3 | ATP-binding cassette transporter, putative | - | - | 6.096e-26 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 4.248e-18 | - |
| Sma3 | Heme-transporting ATPase. | EC:3.6.3.41 | - | 1.598e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | ABC1; At1g15520; At2g29940; B1090H08.39; F23F1.14; GSVIVT00000322001; GSVIVT00012684001; GSVIVT00022062001; GSVIVT00022064001; GSVIVT00032575001; GSVIVT00034491001; GSVIVT00034493001; GSVIVT00034498001; GSVIVT00034501001; GSVIVT00034508001; GSVIVT00034512 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
| Sma3 | lead ion transport | GO:0015692 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
| Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G15520.1 | PDR12, ATPDR12, ABCG40, ATABCG40 pleiotropic drug resistance 12 chr1:5331993-5338175 REVERSE LENGTH=1423 | 1.0e-11 | 65% |
| RefSeq | Arabidopsis thaliana | NP_173005.1 | ABC transporter G family member 40 [Arabidopsis thaliana] | 2.0e-11 | 65% |
| RefSeq | Populus trichocarpa | XP_002297805.1 | predicted protein [Populus trichocarpa] | 1.0e-11 | 73% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACV1
Fln msg: Distance to subject end: 174 aas, your sequence is shorter than subject: 46 - 412
Fln protein:
V
Protein Length:
47
Fln nts:
C
Fln Alignment:
GG46A6U01ARLGP___GFSNAVSVQPVVDAERTVFYREKAAGMSQALPYATAQ
D5ACV1_______________GVSNSSTVQPVVGVQRTVFYREKAAGMYSAIPYAVAQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
