UniGene Name: sp_v3.0_unigene69505
Length: 205 nt
![]() |
---|
>sp_v3.0_unigene69505
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA topoisomerase n=1 Tax=Tribolium castaneum RepID=D2A047_TRICA | - | - | 5.0e-18 | 80% |
FL-Next | tr=Putative uncharacterized protein; Selaginella moellendorffii (Spikemoss). | - | - | 0.0 | 84% |
Source | Gene names |
---|---|
Sma3 | At2g32000; CHLREDRAFT_138607; GSVIVT00033522001; MICPUCDRAFT_51680; MICPUN_79081; Os09g0500600; OsI_31918; OsJ_29901; Ot06g03550; PHYPADRAFT_228008; POPTRDRAFT_1099630; RCOM_1646110; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
Sma3 | DNA topoisomerase type I activity | GO:0003917 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
Sma3 | DNA unwinding involved in replication | GO:0006268 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IQ motif, EF-hand binding site | IPR000048 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IA | IPR000380 | - | 0.0 | - |
Sma3 | Myosin head, motor domain | IPR001609 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | Dilute | IPR002710 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IA, domain 2 | IPR003601 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IA, DNA-binding | IPR003602 | - | 0.0 | - |
Sma3 | IPR006154 | - | 0.0 | - | |
Sma3 | Toprim domain | IPR006171 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IA, central | IPR013497 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IA, central region, subdomain 1 | IPR013824 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IA, central region, subdomain 3 | IPR013826 | - | 0.0 | - |
Sma3 | Dil domain | IPR018444 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G32000.1 | DNA topoisomerase, type IA, core chr2:13615999-13621563 REVERSE LENGTH=865 | 5.0e-22 | 80% |
RefSeq | Arabidopsis thaliana | NP_001031463.1 | DNA topoisomerase III [Arabidopsis thaliana] | 6.0e-22 | 80% |
RefSeq | Populus trichocarpa | XP_002321105.1 | predicted protein [Populus trichocarpa] | 2.0e-19 | 69% |
![]() |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D8R567
Fln msg: Distance to subject end: 556 aas, your sequence is shorter than subject: 68 - 871
Fln protein:
R
Protein Length:
69
Fln nts:
C
Fln Alignment:
GG46A6U01DRQ8T___GLAKVIDVSEKEERKSRPVGLNTVNLLKVASSALGMGPHHAMQIAERLYTQGYISYP
D8R567_______________GSLKVLDVSQKEERKARPTGLNTVNMLKVASTALGMGPHHAMQIAERLYVQGYISYP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain