|
||||||
|
UniGene Name: sp_v3.0_unigene69469
Length: 220 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene69469
C |
|
Ace file of the UniGene sp_v3.0_unigene69469
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | MYB transcription factor MYB161 [Glycine max] | - | - | 4.0e-28 | 84% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
| Sma3 | MYB transcription factor | - | - | 3.643e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g37780; At1g09540; At1g22640; At1g57557; At1g57560; At2g36890; At3g49690; At4g01680; At4g01680/T15B16.4; At4g37780; At4g38620; At5g23000; At5g26660; At5g56110; At5g57620; At5g65790; AtMYB84; DcMYB4; F12K8.1; F14J9.20; F20M13.180; F21E10.4; F6H11.100; G |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | specific transcriptional repressor activity | GO:0016566 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
| Sma3 | response to UV | GO:0009411 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | phenylpropanoid biosynthetic process | GO:0009699 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | blue light signaling pathway | GO:0009785 | Biological Process | 0.0 | - |
| Sma3 | cinnamic acid biosynthetic process | GO:0009800 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of metabolic process | GO:0009892 | Biological Process | 0.0 | - |
| Sma3 | trichome morphogenesis | GO:0010090 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | tapetal layer development | GO:0048658 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol monophosphatase | IPR000760 | - | 0.0 | - |
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | Thiolase | IPR002155 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
| Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
| Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G49690.1 | RAX3, MYB84, ATMYB84 myb domain protein 84 chr3:18427941-18429100 FORWARD LENGTH=310 | 2.0e-36 | 84% |
| RefSeq | Arabidopsis thaliana | NP_190538.1 | transcription factor RAX3 [Arabidopsis thaliana] | 3.0e-36 | 84% |
| RefSeq | Populus trichocarpa | XP_002301137.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-38 | 85% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ABB6
Fln msg: Distance to subject end: 243 aas, your sequence is shorter than subject: 73 - 346
Fln protein:
R
Protein Length:
74
Fln nts:
C
Fln Alignment:
GG46A6U01DEIK8___GCHSIALPQKAGLKRCGKSCRLRWLNYLRPNLKHGGFSEEEDNMIYSLFLSIGSRWSMIAAQLPGRTDN
D5ABB6_______________GGNWLALPQKVGLKRCGKSCRLRWLNYLRPNIKHGGFSEEEDHIICSLYIRIGSRWSIIAAQLPGRTDN
| SSRs (tot: 1) |
|---|
| Start position | End position | Sequence | Length |
|---|---|---|---|
| 126 | 137 | AGA AGA AGA AGA | 12 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
