UniGene Name: sp_v3.0_unigene69384
Length: 185 nt
UniGene Fasta |
---|
>sp_v3.0_unigene69384
C |
Ace file of the UniGene sp_v3.0_unigene69384 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ammonium transporter 1 member 2 n=1 Tax=Solanum lycopersicum RepID=AMT12_SOLLC | - | - | 2.0e-19 | 86% |
FL-Next | sp=Ammonium transporter 1 member 2; Solanum lycopersicum (Tomato) (Lycopersicon esculentum). | - | - | 0.0 | 86% |
Sma3 | Ammonium transporter | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | AMT1; AMT1.1; AMT1.2; AMT1.3; AMT1.4; Amt1; At1g64780; At3g24290; At3g24300; At4g13510; At4g28700; CsAMT1; F13O11.9; F16A16.190; GSVIVT00020387001; GSVIVT00024113001; GSVIVT00026695001; K7M2.6; OJ1234_B11.1; OJ1234_B11.3; OJ1372_D06.26; OJ1372_D06.28; OSI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
Sma3 | ammonium transmembrane transporter activity | GO:0008519 | Molecular Function | 0.0 | - |
Sma3 | high affinity secondary active ammonium transmembrane transporter activity | GO:0015398 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, acting on ester bonds | GO:0016788 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | cytoskeleton organization | GO:0007010 | Biological Process | 0.0 | - |
Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
Sma3 | ammonium transport | GO:0015696 | Biological Process | 0.0 | - |
Sma3 | methylammonium transport | GO:0015843 | Biological Process | 0.0 | - |
Sma3 | protein polymerization | GO:0051258 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ammonium transporter | IPR001905 | - | 0.0 | - |
Sma3 | Villin headpiece | IPR003128 | - | 0.0 | - |
Sma3 | Gelsolin | IPR007122 | - | 0.0 | - |
Sma3 | Gelsolin domain | IPR007123 | - | 0.0 | - |
Sma3 | Phosphoesterase | IPR007312 | - | 0.0 | - |
Sma3 | IPR010256 | - | 0.0 | - | |
Sma3 | Ammonium transporter, conserved site | IPR018047 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G64780.1 | " ATAMT1;2, AMT1;2 ammonium transporter 1;2 chr1:24061021-24062565 REVERSE LENGTH=514" | 5.0e-25 | 84% |
RefSeq | Arabidopsis thaliana | NP_176658.1 | "ammonium transporter 1;2 [Arabidopsis thaliana]" | 7.0e-25 | 84% |
RefSeq | Populus trichocarpa | XP_002338012.1 | ammonium transporter, partial [Populus trichocarpa] | 1.0e-23 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O04161
Fln msg: Distance to subject end: 109 aas, your sequence is shorter than subject: 61 - 514
Fln protein:
R
Protein Length:
62
Fln nts:
C
Fln Alignment:
GG46A6U01ERW96___GFVSAWVLIGFNLLAAKLRYDDPLEAAQLHGGCGAWGIIFTALFAKEEYV
O04161_______________GFIAAWVLIGFNALAAKLKYDDPLEAAQLHGGCGSWGIIFTGLFAKKEYV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain