UniGene Name: sp_v3.0_unigene69364
Length: 238 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene69364
C |
Ace file of the UniGene sp_v3.0_unigene69364
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phosphoinositide-specific phospholipase C P25 n=1 Tax=Glycine max RepID=Q43444_SOYBN | - | - | 9.0e-23 | 72% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Sma3 | Phospholipase C | - | - | 1.249e-31 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphoinositide phospholipase C. | EC:3.1.4.11 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol phosphate metabolism | 00562 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Phosphatidylinositol signaling system | 04070 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | 56B23-g7; 56B23-g8; AT3G08510; AT5G58700; ATHATPLC5; ATHATPLC6; At2g40116; At3g08510; At3g55940; At5g58690; At5g58700; F27K19.120; GSVIVT00021509001; GSVIVT00024092001; GSVIVT00024093001; GSVIVT00024094001; GSVIVT00029292001; GSVIVT00029293001; GSVIVT0003 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | phosphatidylinositol phospholipase C activity | GO:0004435 | Molecular Function | 0.0 | - |
| Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | phosphatidylcholine phospholipase C activity | GO:0034480 | Molecular Function | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
| Sma3 | lipid catabolic process | GO:0016042 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
| Sma3 | Phospholipase C, phosphatidylinositol-specific , X domain | IPR000909 | - | 0.0 | - |
| Sma3 | Phosphoinositide phospholipase C | IPR001192 | - | 0.0 | - |
| Sma3 | Phospholipase C, phosphatidylinositol-specific, Y domain | IPR001711 | - | 0.0 | - |
| Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
| Sma3 | Phospholipase C, phosphoinositol-specific, EF-hand-like | IPR015359 | - | 0.0 | - |
| Sma3 | PLC-like phosphodiesterase, TIM beta/alpha-barrel domain | IPR017946 | - | 0.0 | - |
| Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
| Sma3 | Integrin alpha chain, C-terminal cytoplasmic region, conserved site | IPR018184 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G08510.1 | ATPLC2, PLC2 phospholipase C 2 chr3:2582626-2585556 REVERSE LENGTH=581 | 5.0e-28 | 75% |
| RefSeq | Arabidopsis thaliana | NP_001154596.1 | phosphoinositide phospholipase C 2 [Arabidopsis thaliana] | 6.0e-28 | 75% |
| RefSeq | Populus trichocarpa | XP_002316212.1 | predicted protein [Populus trichocarpa] | 3.0e-28 | 75% |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LLW1
Fln msg: your sequence is shorter than subject: 76 - 597
Fln protein:
R
Protein Length:
77
Fln nts:
C
Fln Alignment:
GG46A6U01EILXN___FPLTVPEIALLRIQVGEYDMSEKDDFGGQTCLPVTELKSGIRSTPLFNKKGEKYMSVKLLLHIEF
B8LLW1_______________FPLTVPELAVLRVEVHEYDMSEKDDFGGQTCVPVAELKSGIRTIPLCNKKGEKYKSVRLLVRIDF

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta