SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene69340

Length: 259 nt

UniGene Fasta

>sp_v3.0_unigene69340
CGTCGTGACCTTGGCTGTCACTCATTATCTCGGATCTTCCCCAAGGATATAACACATGTGNGGGGGAGCGTGGGGTGCAGTTATCTGGAGGTCAAAAGCAACGCATAGCAATTGCAAGAGCAATAATTAAAGACCCTATGATATTGTTGTTAGATGAAGCTACAAGTGCATTGGATGCTGAATCTGAGCGCATAGTTCAAGATGCATTGGATCGTGTAATGGTAAATAGGACCACTATTGTTGTTGCTCATCGTCTTTC

Ace file of the UniGene sp_v3.0_unigene69340

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	P-glycoprotein 9 n=2 Tax=Arabidopsis RepID=F4JQQ3_ARATH	-	-	2.0e-25	79%
FL-Next	tr=MDR-like ABC transporter; Taxus cuspidata (Japanese yew).	-	-	0.0	88%
Sma3	Multidrug/pheromone exporter, MDR family, ABC transporter family	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Phosphate-transporting ATPase.	EC:3.6.3.27	-	1.27e-17	-
Sma3	Peptide-transporting ATPase.	EC:3.6.3.43	-	7.53e-08	-
Sma3	Xenobiotic-transporting ATPase.	EC:3.6.3.44	-	0.0	-

Source	Gene names
Sma3	170F8.4; ALS1; At1g02520; At1g02530; At1g10680; At1g27940; At1g28010; At2g36910; At2g47000; At3g28344; At3g28345; At3g28360; At3g28380; At3g28390; At3g28415; At3g28860; At3g30875; At3g62150; At4g01820; At4g01830; At4g18050; At4g25450; At4g25960; At5g39040

Source	GOs	Term	Type	Identity
Sma3	plant-type vacuole	GO:0000325	Cellular Component	-
Sma3	vacuolar membrane	GO:0005774	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	xenobiotic-transporting ATPase activity	GO:0008559	Molecular Function	-
Sma3	auxin efflux transmembrane transporter activity	GO:0010329	Molecular Function	-
Sma3	ATPase activity	GO:0016887	Molecular Function	-
Sma3	ATPase activity, coupled to transmembrane movement of substances	GO:0042626	Molecular Function	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	regulation of cell size	GO:0008361	Biological Process	-
Sma3	gravitropism	GO:0009630	Biological Process	-
Sma3	response to blue light	GO:0009637	Biological Process	-
Sma3	photomorphogenesis	GO:0009640	Biological Process	-
Sma3	auxin mediated signaling pathway	GO:0009734	Biological Process	-
Sma3	response to cytokinin stimulus	GO:0009735	Biological Process	-
Sma3	positive gravitropism	GO:0009958	Biological Process	-
Sma3	response to far red light	GO:0010218	Biological Process	-
Sma3	auxin efflux	GO:0010315	Biological Process	-
Sma3	basipetal auxin transport	GO:0010540	Biological Process	-
Sma3	acropetal auxin transport	GO:0010541	Biological Process	-
Sma3	anthocyanin accumulation in tissues in response to UV light	GO:0043481	Biological Process	-
Sma3	stamen development	GO:0048443	Biological Process	-
Sma3	lateral root development	GO:0048527	Biological Process	-
Sma3	root hair elongation	GO:0048767	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	ABC transporter, transmembrane domain	IPR001140	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Ribosomal protein L10, eubacterial, conserved site	IPR002363	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	K Homology domain, type 1	IPR004088	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Inorganic pyrophosphatase	IPR008162	-	-
Sma3	Leucine-rich repeat 2	IPR013101	-	-
Sma3		IPR013596	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	ABC transporter, integral membrane type 1	IPR017940	-	-
Sma3	Cytochrome P450, conserved site	IPR017972	-	-
Sma3	Peroxidases heam-ligand binding site	IPR019793	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G18050.1	PGP9 P-glycoprotein 9 chr4:10022205-10027280 FORWARD LENGTH=1236	1.0e-31	89%
RefSeq	Arabidopsis thaliana	NP_193539.6	P-glycoprotein 9 [Arabidopsis thaliana]	2.0e-31	89%
RefSeq	Populus trichocarpa	XP_002331877.1	multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa]	7.0e-30	87%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: E6Y0T0

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 43 aas, your sequence is shorter than subject: 85 - 1316

Fln protein: S*PWLSLIISDLPQGYNTCEGERGVQLSGGQKQRIAIARAIIKDPMILLLDEATSALDAESERIVQDALDRVMVNRTTIVVAHRL

Protein Length: 86

Fln nts: CGTCGTGACCTTGGCTGTCACTCATTATCTCGGATCTTCCCCAAGGATATAACACATGTGaGGGGGAGCGTGGGGTGCAGTTATCTGGAGGTCAAAAGCAACGCATAGCAATTGCAAGAGCAATAATTAAAGACCCTATGATATTGTTGTTAGATGAAGCTACAAGTGCATTGGATGCTGAATCTGAGCGCATAGTTCAAGATGCATTGGATCGTGTAATGGTAAATAGGACCACTATTGTTGTTGCTCATCGTCTTTC

Fln Alignment:

GG46A6U01DY8SB___ISDLPQGYNTCEGERGVQLSGGQKQXXXXXXXXXKDPMILLLDEATSALDAESERIVQDALDRVMVNRTTIVVAHRL
E6Y0T0_______________ISSLPQGYNINVGERGVQLSGGQKQRIAIARAILKDPRILLLDEATSALDAESERIVQDALDRVKVNRSTIVIAHRL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain