SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene69315

Length: 198 nt

UniGene Fasta

>sp_v3.0_unigene69315
CGTCGTGACCTTGGCTGTCACTCAGGTTTTGCACTTGGTGGTGGCTTTGGAGTTGGCAATGGCTTGCAATGCACGTATAACTGCCCCTAATGTTCAACTTGGACTTGTTGAACTTCAACTTGGTATCATTCCAGGACTTGGAGGCACACAACGATTGCCTCGATTGGTTGGACTTCAATTTGCAATTGACATGTTACT

Ace file of the UniGene sp_v3.0_unigene69315

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	fatty acid multifunctional protein (AtMFP2) [Arabidopsis thaliana]	-	-	6.0e-14	65%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	63%
Sma3	Peroxisomal fatty acid beta-oxidation multifunctional protein	-	-	8.885e-12	-

Source	ECs	Term	Type	e value	Identity
Sma3	3-hydroxyacyl-CoA dehydrogenase.	EC:1.1.1.35	-	7.457e-10	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Fatty acid elongation in mitochondria	00062		7.457e-10	%
Sma3	Fatty acid metabolism	00071		7.457e-10	%
Sma3	Primary bile acid biosynthesis	00120		7.457e-10	%
Sma3	Valine, leucine and isoleucine degradation	00280		7.457e-10	%
Sma3	Geraniol degradation	00281		7.457e-10	%
Sma3	Lysine degradation	00310		7.457e-10	%
Sma3	Tryptophan metabolism	00380		7.457e-10	%
Sma3	Toluene degradation	00623		7.457e-10	%
Sma3	Butanoate metabolism	00650		7.457e-10	%
Sma3	Carbon fixation pathways in prokaryotes	00720		7.457e-10	%
Sma3	Biosynthesis of plant hormones	01070		7.457e-10	%
Sma3	Metabolic pathways	01100		7.457e-10	%
Sma3	Biosynthesis of secondary metabolites	01110		7.457e-10	%
Sma3	Enoyl-CoA hydratase.	EC:4.2.1.17	-	1.01e-08	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Fatty acid elongation in mitochondria	00062		1.01e-08	%
Sma3	Fatty acid metabolism	00071		1.01e-08	%
Sma3	Valine, leucine and isoleucine degradation	00280		1.01e-08	%
Sma3	Geraniol degradation	00281		1.01e-08	%
Sma3	Lysine degradation	00310		1.01e-08	%
Sma3	Benzoate degradation	00362		1.01e-08	%
Sma3	Tryptophan metabolism	00380		1.01e-08	%
Sma3	beta-Alanine metabolism	00410		1.01e-08	%
Sma3	alpha-Linolenic acid metabolism	00592		1.01e-08	%
Sma3	Aminobenzoate degradation	00627		1.01e-08	%
Sma3	Propanoate metabolism	00640		1.01e-08	%
Sma3	Butanoate metabolism	00650		1.01e-08	%
Sma3	Limonene and pinene degradation	00903		1.01e-08	%
Sma3	Biosynthesis of unsaturated fatty acids	01040		1.01e-08	%
Sma3	Biosynthesis of plant hormones	01070		1.01e-08	%
Sma3	Metabolic pathways	01100		1.01e-08	%
Sma3	Biosynthesis of secondary metabolites	01110		1.01e-08	%
Sma3	3-hydroxybutyryl-CoA epimerase.	EC:5.1.2.3	-	6.408e-14	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Fatty acid metabolism	00071		6.408e-14	%
Sma3	Butanoate metabolism	00650		6.408e-14	%
Sma3	Dodecenoyl-CoA isomerase.	EC:5.3.3.8	-	8.882e-11	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Fatty acid metabolism	00071		8.882e-11	%

Source	Gene names
Sma3	AIM1; AT4g29010; At3g06860; At3g06860/F17A9.1; At4g29010; At4g29010/F19B15.40; B1051E10.10; F17A9.1; F19B15.40; GSVIVT00016719001; GSVIVT00033022001; LOC_Os02g17390; MFP; MICPUCDRAFT_45151; MICPUN_94758; NtMFP; OSTLU_49128; Os01g0348600; Os02g0274100; Os0

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	nucleolus	GO:0005730	Cellular Component	-
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	microtubule	GO:0005874	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	glyoxysome	GO:0009514	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	mRNA binding	GO:0003729	Molecular Function	-
Sma3	3-hydroxyacyl-CoA dehydrogenase activity	GO:0003857	Molecular Function	-
Sma3	dodecenoyl-CoA delta-isomerase activity	GO:0004165	Molecular Function	-
Sma3	enoyl-CoA hydratase activity	GO:0004300	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	microtubule binding	GO:0008017	Molecular Function	-
Sma3	3-hydroxybutyryl-CoA epimerase activity	GO:0008692	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	3-hydroxyacyl-CoA dehydratase activity	GO:0018812	Molecular Function	-
Sma3	coenzyme binding	GO:0050662	Molecular Function	-
Sma3	fatty acid metabolic process	GO:0006631	Biological Process	-
Sma3	fatty acid beta-oxidation	GO:0006635	Biological Process	-
Sma3	cell adhesion	GO:0007155	Biological Process	-
Sma3	flower development	GO:0009908	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Crotonase, core	IPR001753	-	-
Sma3	CD36 antigen	IPR002159	-	-
Sma3	3-hydroxyacyl-CoA dehydrogenase, C-terminal	IPR006108	-	-
Sma3	3-hydroxyacyl-CoA dehydrogenase, NAD binding	IPR006176	-	-
Sma3	3-hydroxyacyl-CoA dehydrogenase, conserved site	IPR006180	-	-
Sma3	Dehydrogenase, multihelical	IPR013328	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Enoyl-CoA hydratase/isomerase, conserved site	IPR018376	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G06860.1	MFP2, ATMFP2 multifunctional protein 2 chr3:2161926-2166009 FORWARD LENGTH=725	2.0e-18	65%
RefSeq	Arabidopsis thaliana	NP_187342.1	enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [Arabidopsis thaliana]	2.0e-18	65%
RefSeq	Populus trichocarpa	XP_002336529.1	predicted protein [Populus trichocarpa]	7.0e-18	61%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LR51

Fln msg: Distance to subject end: 559 aas, your sequence is shorter than subject: 65 - 723

Fln protein: VVTLAVTQVLHLVVALELAMACNARITAPNVQLGLVELQLGIIPGLGGTQRLPRLVGLQFAIDML

Protein Length: 66

Fln nts: CGTCGTGACCTTGGCTGTCACTCAGGTTTTGCACTTGGTGGTGGCTTTGGAGTTGGCAATGGCTTGCAATGCACGTATAACTGCCCCTAATGTTCAACTTGGACTTGTTGAACTTCAACTTGGTATCATTCCAGGACTTGGAGGCACACAACGATTGCCTCGATTGGTTGGACTTCAATTTGCAATTGACATGTTACT

Fln Alignment:

GG46A6U01EK657___TLAVTQVLHLVVALELAMACNARITAPNVQLGLVELQLGIIPGLGGTQRLPRLVGLQFAIDML
B8LR51_______________SVAAIQGLALGGGLELAMSCHARISTPKALLGLPELQLGIFPGFGGTQRLPRLVGLQKAVEMM

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain