UniGene Name: sp_v3.0_unigene69302
Length: 149 nt
UniGene Fasta |
---|
>sp_v3.0_unigene69302
C |
Ace file of the UniGene sp_v3.0_unigene69302 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | cullin 1C [Nicotiana tabacum] | - | - | 1.0e-12 | 87% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
Sma3 | Putative cullin | - | - | 5.558e-08 | - |
Source | Gene names |
---|---|
Sma3 | AXR6; At4g02570; CUL1; CUL1-C; CUL1-G; GSVIVT00019763001; GSVIVT00023565001; OJ1504_G04.11; OSJNBa0010P20.16; OSJNBa0010P20.19; Os01g0369000; Os01g0369200; Os05g0149600; OsI_01951; OsI_01952; OsI_18469; OsJ_01786; OsJ_01787; OsJ_17132; P0043B10.31; P0043B |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | condensed nuclear chromosome | GO:0000794 | Cellular Component | 0.0 | - |
Sma3 | spindle | GO:0005819 | Cellular Component | 0.0 | - |
Sma3 | phragmoplast | GO:0009524 | Cellular Component | 0.0 | - |
Sma3 | cullin-RING ubiquitin ligase complex | GO:0031461 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin protein ligase binding | GO:0031625 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | jasmonic acid mediated signaling pathway | GO:0009867 | Biological Process | 0.0 | - |
Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
Sma3 | SCF complex assembly | GO:0010265 | Biological Process | 0.0 | - |
Sma3 | regulation of circadian rhythm | GO:0042752 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cullin, N-terminal | IPR001373 | - | 0.0 | - |
Sma3 | Protein translocase complex, SecE/Sec61-gamma subunit | IPR001901 | - | 0.0 | - |
Sma3 | Winged helix-turn-helix transcription repressor DNA-binding | IPR011991 | - | 0.0 | - |
Sma3 | Cullin, conserved site | IPR016157 | - | 0.0 | - |
Sma3 | Cullin homology | IPR016158 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02570.1 | ATCUL1, CUL1, AXR6 cullin 1 chr4:1129315-1133435 FORWARD LENGTH=738 | 8.0e-16 | 80% |
RefSeq | Arabidopsis thaliana | NP_001190661.1 | cullin 1 [Arabidopsis thaliana] | 1.0e-15 | 80% |
RefSeq | Populus trichocarpa | XP_002314453.1 | predicted protein [Populus trichocarpa] | 3.0e-17 | 87% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQB2
Fln msg: Distance to subject end: 197 aas, your sequence is shorter than subject: 49 - 744
Fln protein:
R
Protein Length:
50
Fln nts:
C
Fln Alignment:
GG46A6U01DKRNW___HSGIDLTLKVLTTGFWPSYKSFGLINLPAEMVKCVEVFKEFYQ
B8LQB2_______________HPGIDLTVTVLTTGFWPSYKSFDL-NLPAEMVKCVEVFKEFYQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain