UniGene Name: sp_v3.0_unigene69292
Length: 186 nt
UniGene Fasta |
---|
>sp_v3.0_unigene69292
C |
Ace file of the UniGene sp_v3.0_unigene69292 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Protein kinase n=4 Tax=Andropogoneae RepID=B6SY15_MAIZE | - | - | 2.0e-13 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
Sma3 | Receptor-like serine/threonine kinase | - | - | 6.695e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.944e-06 | - |
Source | Gene names |
---|---|
Sma3 | AT1G29720; AT1G29750; AT3G14840; AT4g32710; At1g11050; At1g29720; At1g29750; At2g48010; At3g58690/T20N10_40; At4g04500; At4g23230; At4g32710; At5g02800; B1065E10.29; CRK15; CRK37; F1N18.19; F1N18.22; F21P8.120; F4D11.90; F8K4.7; F9G14_110; GSVIVT000154400 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like domain | IPR000742 | - | 0.0 | - |
Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Protein translocase complex, SecE/Sec61-gamma subunit | IPR001901 | - | 0.0 | - |
Sma3 | Gnk2-homologous domain | IPR002902 | - | 0.0 | - |
Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Beta-ketoacyl synthase, active site | IPR018201 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G11050.1 | Protein kinase superfamily protein chr1:3681892-3683769 FORWARD LENGTH=625 | 8.0e-18 | 67% |
RefSeq | Arabidopsis thaliana | NP_172572.1 | putative receptor-like protein kinase [Arabidopsis thaliana] | 1.0e-17 | 67% |
RefSeq | Populus trichocarpa | XP_002301677.1 | predicted protein [Populus trichocarpa] | 3.0e-17 | 66% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACH5
Fln msg: Distance to subject end: 124 aas, your sequence is shorter than subject: 61 - 246
Fln protein:
V
Protein Length:
62
Fln nts:
C
Fln Alignment:
GG46A6U01A4AZ3___AVTHDFGLARMMSKAEGFHWMSRVVGTHGYMAPEYALYGQLTDKNDVYSFGVLLLEI
D5ACH5_______________AFVADFGLARMMTKGGESHITTKVAGTHGYLAPEYALYGQLTDKSDVYSFGVLLLEI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain