UniGene Name: sp_v3.0_unigene69258
Length: 166 nt
UniGene Fasta |
---|
>sp_v3.0_unigene69258
C |
Ace file of the UniGene sp_v3.0_unigene69258 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cytosolic aldehyde dehydrogenase RF2D n=3 Tax=Andropogoneae RepID=Q8S529_MAIZE | - | - | 5.0e-13 | 73% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
Sma3 | Aldehyde dehydrogenase | - | - | 4.276e-25 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aldehyde dehydrogenase (NAD(+)). | EC:1.2.1.3 | - | 3.988e-11 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 3.988e-11 | % | |
Sma3 | Pentose and glucuronate interconversions | 00040 | 3.988e-11 | % | |
Sma3 | Ascorbate and aldarate metabolism | 00053 | 3.988e-11 | % | |
Sma3 | Fatty acid metabolism | 00071 | 3.988e-11 | % | |
Sma3 | Valine, leucine and isoleucine degradation | 00280 | 3.988e-11 | % | |
Sma3 | Lysine degradation | 00310 | 3.988e-11 | % | |
Sma3 | Arginine and proline metabolism | 00330 | 3.988e-11 | % | |
Sma3 | Histidine metabolism | 00340 | 3.988e-11 | % | |
Sma3 | Tryptophan metabolism | 00380 | 3.988e-11 | % | |
Sma3 | beta-Alanine metabolism | 00410 | 3.988e-11 | % | |
Sma3 | Glycerolipid metabolism | 00561 | 3.988e-11 | % | |
Sma3 | Pyruvate metabolism | 00620 | 3.988e-11 | % | |
Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 3.988e-11 | % | |
Sma3 | Propanoate metabolism | 00640 | 3.988e-11 | % | |
Sma3 | Limonene and pinene degradation | 00903 | 3.988e-11 | % | |
Sma3 | Metabolic pathways | 01100 | 3.988e-11 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.988e-11 | % | |
Sma3 | Retinal dehydrogenase. | EC:1.2.1.36 | - | 2.932e-14 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Retinol metabolism | 00830 | 2.932e-14 | % | |
Sma3 | Metabolic pathways | 01100 | 2.932e-14 | % |
Source | Gene names |
---|---|
Sma3 | ALDH; ALDH1a; ALDH2; ALDH2A; ALDH2B4; ALDH2C4; ALDH2a; ALDH2b; ALDH5A; ALDH5B; ALDH5F1; Aldh 2A; Aldh1; Aldh2a; At1g79440; At3g24503; At3g48000; CHLREDRAFT_135609; GSVIVT00002098001; GSVIVT00002101001; GSVIVT00016121001; GSVIVT00028844001; LeSSADH; MOB24. |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | aldehyde dehydrogenase (NAD) activity | GO:0004029 | Molecular Function | 0.0 | - |
Sma3 | aldehyde dehydrogenase [NAD(P)+] activity | GO:0004030 | Molecular Function | 0.0 | - |
Sma3 | succinate-semialdehyde dehydrogenase activity | GO:0004777 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor | GO:0016620 | Molecular Function | 0.0 | - |
Sma3 | coniferyl-aldehyde dehydrogenase activity | GO:0050269 | Molecular Function | 0.0 | - |
Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
Sma3 | glutamate decarboxylation to succinate | GO:0006540 | Biological Process | 0.0 | - |
Sma3 | oxygen and reactive oxygen species metabolic process | GO:0006800 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
Sma3 | gamma-aminobutyric acid catabolic process | GO:0009450 | Biological Process | 0.0 | - |
Sma3 | phenylpropanoid biosynthetic process | GO:0009699 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Succinic semialdehyde dehydrogenase | IPR010102 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase domain | IPR015590 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, N-terminal | IPR016162 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G24503.1 | ALDH2C4, ALDH1A, REF1 aldehyde dehydrogenase 2C4 chr3:8919732-8923029 REVERSE LENGTH=501 | 6.0e-15 | 65% |
RefSeq | Arabidopsis thaliana | NP_566749.1 | aldehyde dehydrogenase 2C4 [Arabidopsis thaliana] | 8.0e-15 | 65% |
RefSeq | Populus trichocarpa | XP_002324977.1 | predicted protein [Populus trichocarpa] | 4.0e-15 | 66% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P2L9
Fln msg: Distance to subject end: 127 aas, your sequence is shorter than subject: 55 - 200
Fln protein:
V
Protein Length:
56
Fln nts:
C
Fln Alignment:
GG46A6U01C3PDT___LVMFFIKIAPALACGCTVVIKPAEQTPLTALYCAHLAKEAGLPPGVL
A9P2L9_______________MVMFFSKISPALACGCTVVIKSAEQTPLTALYCAQLAKEAGIPPGVL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain