|
||||||
|
UniGene Name: sp_v3.0_unigene69238
Length: 201 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene69238
C |
|
Ace file of the UniGene sp_v3.0_unigene69238
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Sucrose synthase-like protein (Fragment) n=2 Tax=Picea sitchensis RepID=E0ZGJ9_PICSI | - | - | 4.0e-23 | 81% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
| Sma3 | Sucrose synthase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sucrose synthase. | EC:2.4.1.13 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g43190; At4g02280; At5g20830; At5g49190; B1056G08.118; CitSUS1; CitSUS1-2; CitSUSA; CitSUSA-2; F7K15_40; GSVIVT00000882001; GSVIVT00016378001; GSVIVT00028036001; GSVIVT00033041001; K21P3.6; LOC_Os03g22120; LOC_Os03g28330; LOC_Os06g09450; LOC_Os07g42490 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | sucrose synthase activity | GO:0016157 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
| Sma3 | sucrose-phosphate synthase activity | GO:0046524 | Molecular Function | 0.0 | - |
| Sma3 | response to hypoxia | GO:0001666 | Biological Process | 0.0 | - |
| Sma3 | sucrose metabolic process | GO:0005985 | Biological Process | 0.0 | - |
| Sma3 | response to osmotic stress | GO:0006970 | Biological Process | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to flooding | GO:0009413 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sucrose synthase | IPR000368 | - | 0.0 | - |
| Sma3 | Glycosyl transferase, family 1 | IPR001296 | - | 0.0 | - |
| Sma3 | Sucrose synthase, plant/cyanobacteria | IPR012820 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G02280.1 | SUS3, ATSUS3 sucrose synthase 3 chr4:995166-998719 FORWARD LENGTH=809 | 1.0e-23 | 66% |
| RefSeq | Arabidopsis thaliana | NP_192137.1 | sucrose synthase 3 [Arabidopsis thaliana] | 1.0e-23 | 66% |
| RefSeq | Populus trichocarpa | XP_002324136.1 | hypothetical protein POPTRDRAFT_835735 [Populus trichocarpa] | 6.0e-25 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NRB7
Fln msg: Distance to subject end: 53 aas, atg_distance in limit (1-15): atg_distance = 16, W2: There is no M at the beginning, your sequence is shorter than subject: 67 - 135
Fln protein:
R
Protein Length:
68
Fln nts:
C
Fln Alignment:
GG46A6U01DIM5A___SGFHIDPYHGDSASEHIVNFFERCQTDPTYWDKISSAGLQRIYERYTWQIYAKRLMTLS
A9NRB7_______________SGFHIDPYHGDSASERIADFFEKCKTDPSYWIKISNGGLQRIYERYTWKIYAEKLMTLS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
