UniGene Name: sp_v3.0_unigene69189
Length: 186 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene69189
C |
Ace file of the UniGene sp_v3.0_unigene69189
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Multicopper oxidase, putative n=1 Tax=Ricinus communis RepID=B9SR02_RICCO | - | - | 3.0e-16 | 74% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
| Sma3 | Multicopper oxidase, putative | - | - | 9.439e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 4.942e-12 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 4.942e-12 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.942e-12 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT1G41830; AT1G76160; AT4g28090; AT4g38420; At1g21850; At1g21860; At1g41830; At1g55570; At1g76160; At3g13390; At3g13400; At4g12420; At4g28090; At4g38420; B1148D12.11; Bp10; Bplo; F22I13.190; F5A13.5; GSVIVT00003897001; GSVIVT00010974001; GSVIVT00015539001 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | anchored to plasma membrane | GO:0046658 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | pectinesterase activity | GO:0030599 | Molecular Function | 0.0 | - |
| Sma3 | cell tip growth | GO:0009932 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
| Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
| Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G76160.1 | sks5 SKU5 similar 5 chr1:28578211-28581020 REVERSE LENGTH=541 | 3.0e-20 | 70% |
| RefSeq | Arabidopsis thaliana | NP_177743.1 | SKU5 similar 5 protein [Arabidopsis thaliana] | 4.0e-20 | 70% |
| RefSeq | Populus trichocarpa | XP_002301616.1 | predicted protein [Populus trichocarpa] | 3.0e-21 | 72% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRP4
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 366 aas, your sequence is shorter than subject: 61 - 542
Fln protein:
S
Protein Length:
62
Fln nts:
C
Fln Alignment:
GG46A6U01BVSGA___SYFYFPSLYMQKAAGGFGGLNVASRLLIPVPFPDPAGDITLLIGDWYKRQH
B8LRP4_______________SYYYFPSMYMHKAAGGFGGLSVVSRPLIPVPFPAPNGDITLLIGDWYKANH

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta