UniGene Name: sp_v3.0_unigene69066
Length: 208 nt
![]() |
---|
>sp_v3.0_unigene69066
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | myosin motor domain-containing protein and DIL domain-containing protein [Arabidopsis thaliana] gb|AEE28340.1| myosin motor domain-containing protein and DIL domain-containing protein [Arabidopsis thaliana] | - | - | 1.0e-07 | 65% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 81% |
Sma3 | Myosin XI, putative | - | - | 7.002e-08 | - |
Source | Gene names |
---|---|
Sma3 | 41C02.1; GSVIVT00007440001; GSVIVT00027091001; GSVIVT00034148001; Os06g0488200; OsI_23028; OsJ_21402; P0583E12.11; POPTRDRAFT_773763; POPTRDRAFT_787203; RCOM_0608040; RCOM_1046280; VITISV_019007; hamy5; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IQ motif, EF-hand binding site | IPR000048 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Myosin head, motor domain | IPR001609 | - | 0.0 | - |
Sma3 | Dilute | IPR002710 | - | 0.0 | - |
Sma3 | HAMP linker domain | IPR003660 | - | 0.0 | - |
Sma3 | Myosin, N-terminal, SH3-like | IPR004009 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Dil domain | IPR018444 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G08730.1 | XIC, ATXIC Myosin family protein with Dil domain chr1:2779963-2788325 FORWARD LENGTH=1538 | 4.0e-11 | 65% |
RefSeq | Arabidopsis thaliana | NP_172349.2 | myosin motor domain-containing protein and DIL domain-containing protein [Arabidopsis thaliana] | 5.0e-11 | 65% |
RefSeq | Populus trichocarpa | XP_002332026.1 | predicted protein [Populus trichocarpa] | 2.0e-13 | 76% |
![]() |
---|
Fln status: C-terminus
Fln database: tr_plants
Fln subject: F6HVL1
Fln msg: your sequence is shorter than subject: 47 - 1523
Fln protein:
V
Protein Length:
48
Fln nts:
C
Fln Alignment:
GG46A6U01BLZ0L___FSVDDISKSMNQIDLSEIEPPPLIRQNSAFNFLLPRAE
F6HVL1_______________FSVDDISKSMEQIDISDIEPPPLIRENSGFSFLLPRAD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain