UniGene Name: sp_v3.0_unigene69031
Length: 161 nt
![]() |
---|
>sp_v3.0_unigene69031
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | D-xylose-proton symporter-like 1 n=2 Tax=Arabidopsis RepID=XYLL1_ARATH | - | - | 4.0e-10 | 69% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
Sma3 | Sugar transporter, putative | - | - | 5.728e-06 | - |
Source | Gene names |
---|---|
Sma3 | At3g03090; At5g17010; F2K13.160; GSVIVT00014041001; LOC_Os10g42830; OSJNBa0056G17.3; Os10g0579200; OsI_34793; OsJ_32598; POPTRDRAFT_1108211; RCOM_0733170; RCOM_1324650; T17B22.22; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type vacuole membrane | GO:0009705 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | sugar:hydrogen symporter activity | GO:0005351 | Molecular Function | 0.0 | - |
Sma3 | fructose transmembrane transporter activity | GO:0005353 | Molecular Function | 0.0 | - |
Sma3 | glucose transmembrane transporter activity | GO:0005355 | Molecular Function | 0.0 | - |
Sma3 | substrate-specific transmembrane transporter activity | GO:0022891 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate transport | GO:0008643 | Biological Process | 0.0 | - |
Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
Sma3 | seed germination | GO:0009845 | Biological Process | 0.0 | - |
Sma3 | positive regulation of flower development | GO:0009911 | Biological Process | 0.0 | - |
Sma3 | fructose transport | GO:0015755 | Biological Process | 0.0 | - |
Sma3 | glucose transport | GO:0015758 | Biological Process | 0.0 | - |
Sma3 | transmembrane transport | GO:0055085 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
Sma3 | Sugar/inositol transporter | IPR003663 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G03090.1 | AtVGT1, VGT1 vacuolar glucose transporter 1 chr3:700749-704579 REVERSE LENGTH=503 | 1.0e-14 | 69% |
RefSeq | Arabidopsis thaliana | NP_186959.2 | D-xylose-proton symporter-like 1 [Arabidopsis thaliana] | 1.0e-14 | 69% |
RefSeq | Populus trichocarpa | XP_002325479.1 | predicted protein [Populus trichocarpa] | 3.0e-14 | 71% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWB2
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 23 aas, your sequence is shorter than subject: 53 - 521
Fln protein:
S
Protein Length:
54
Fln nts:
C
Fln Alignment:
GG46A6U01AEZ11___KGLSIAVLVNFSANALVTFSFSPLRVLLGAAILFLIFGIIDIVAL
A9NWB2_______________RGISVAVLVNFASNALVTFSFSPLQELLGASMLFVTFGVIALLSL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain