|
||||||
|
UniGene Name: sp_v3.0_unigene69024
Length: 241 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene69024
C |
|
Ace file of the UniGene sp_v3.0_unigene69024
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative sugar transporter [Arabidopsis thaliana] | - | - | 3.0e-16 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Sma3 | Mannitol transporter | - | - | 7.703e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g16130; At2g18480; At2g20780; At3g18830; BvcDNA-205; BvcDNA-397; F24H14.17; F5H14.25; F7H1.15; GSVIVT00010278001; GSVIVT00025836001; GSVIVT00036419001; H0801D08.10; H0801D08.9; LOC_Os03g10090; MVE11.10; MVE11.22; MaT1; MaT2; MaT3; Mat1; MdSOT3; MdSOT5; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | sugar:hydrogen symporter activity | GO:0005351 | Molecular Function | 0.0 | - |
| Sma3 | galactose transmembrane transporter activity | GO:0005354 | Molecular Function | 0.0 | - |
| Sma3 | glucose transmembrane transporter activity | GO:0005355 | Molecular Function | 0.0 | - |
| Sma3 | myo-inositol transmembrane transporter activity | GO:0005365 | Molecular Function | 0.0 | - |
| Sma3 | D-xylose transmembrane transporter activity | GO:0015148 | Molecular Function | 0.0 | - |
| Sma3 | glycerol transmembrane transporter activity | GO:0015168 | Molecular Function | 0.0 | - |
| Sma3 | mannitol transmembrane transporter activity | GO:0015575 | Molecular Function | 0.0 | - |
| Sma3 | sorbitol transmembrane transporter activity | GO:0015576 | Molecular Function | 0.0 | - |
| Sma3 | D-ribose transmembrane transporter activity | GO:0015591 | Molecular Function | 0.0 | - |
| Sma3 | substrate-specific transmembrane transporter activity | GO:0022891 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate transport | GO:0008643 | Biological Process | 0.0 | - |
| Sma3 | transmembrane transport | GO:0055085 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sugar/inositol transporter | IPR003663 | - | 0.0 | - |
| Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G20780.1 | Major facilitator superfamily protein chr2:8947496-8949170 REVERSE LENGTH=526 | 3.0e-21 | 68% |
| RefSeq | Arabidopsis thaliana | NP_179671.2 | putative polyol transporter 4 [Arabidopsis thaliana] | 4.0e-21 | 68% |
| RefSeq | Populus trichocarpa | XP_002319907.1 | predicted protein [Populus trichocarpa] | 1.0e-21 | 73% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLD6
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 424 aas, your sequence is shorter than subject: 80 - 538
Fln protein:
V
Protein Length:
81
Fln nts:
C
Fln Alignment:
GG46A6U01EP13N___DGGVMSGAIIFIQEDLVITEVQEEVLVGSLNIFCLAGAAIAGRTSDAIGRRWTMALEALIFL
B8LLD6_______________DVGVMSGAVIFIKKDLKISDVQEEVLIGSLNIISLVGAALAGRTSDAIGRRWTMALAAFIFL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
