UniGene Name: sp_v3.0_unigene68990
Length: 206 nt
![]() |
---|
>sp_v3.0_unigene68990
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | naringenin 3-dioxygenase like protein [Brassica napus] | - | - | 3.0e-18 | 70% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 98% |
Sma3 | 1-aminocyclopropane-1-carboxylate oxidase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavanone 3-dioxygenase. | EC:1.14.11.9 | - | 1.091e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavonoid biosynthesis | 00941 | 1.091e-09 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.091e-09 | % | |
Sma3 | Metabolic pathways | 01100 | 1.091e-09 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.091e-09 | % | |
Sma3 | Aminocyclopropanecarboxylate oxidase. | EC:1.14.17.4 | - | 1.764e-30 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cysteine and methionine metabolism | 00270 | 1.764e-30 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 1.764e-30 | % | |
Sma3 | Metabolic pathways | 01100 | 1.764e-30 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.764e-30 | % |
Source | Gene names |
---|---|
Sma3 | AB-ACO1; ACC oxidase; ACO; ACO1; ACO15; ACO2; ACO3; ACO31; ACO4; ACO6; ACO7; AT4g10490; AT4g16330; Aco1; Aco2a; Aco2b; At1g05010; At1g62380; At1g77330; At4g10490; At4g16330; At5g24530; BA-ACO; CS-ACO1; Cs-ACO3; DC-ACO1; DK-ACO2; EAT1; EFEMR2; ETR1; F24O1. |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | 1-aminocyclopropane-1-carboxylate oxidase activity | GO:0009815 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
Sma3 | L-ascorbic acid binding | GO:0031418 | Molecular Function | 0.0 | - |
Sma3 | naringenin 3-dioxygenase activity | GO:0045486 | Molecular Function | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | response to fungus | GO:0009620 | Biological Process | 0.0 | - |
Sma3 | ethylene biosynthetic process | GO:0009693 | Biological Process | 0.0 | - |
Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Isopenicillin N synthase | IPR002283 | - | 0.0 | - |
Sma3 | Oxoglutarate/iron-dependent oxygenase | IPR005123 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G16330.2 | - | 2.0e-23 | 67% |
RefSeq | Arabidopsis thaliana | NP_567491.5 | oxidoreductase [Arabidopsis thaliana] | 2.0e-23 | 67% |
RefSeq | Populus trichocarpa | XP_002317200.1 | predicted protein [Populus trichocarpa] | 8.0e-23 | 68% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADL4
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 73 aas, your sequence is shorter than subject: 68 - 261
Fln protein:
S
Protein Length:
69
Fln nts:
C
Fln Alignment:
GG46A6U01DPYC0___ITLGLQAHSDMGAITLLIQDEVGGLQVLKDGQWITVQPLPDAIVVNLGDQTQILTNGAYKS
D5ADL4_______________LTLGLQAHSDMGAITLLIQDEVGGLQVLKDGQWITVQPLPDAIVVNLGDQTQILTNGAYKS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain