UniGene Name: sp_v3.0_unigene68937
Length: 240 nt
UniGene Fasta |
---|
>sp_v3.0_unigene68937
C |
Ace file of the UniGene sp_v3.0_unigene68937 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative potasium transporter [Oryza sativa Japonica Group] | - | - | 5.0e-19 | 83% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
Sma3 | Potassium transporter, putative | - | - | 3.626e-23 | - |
Source | Gene names |
---|---|
Sma3 | 6J23.11; At1g31120; At1g60160; At1g70300; At2g30070; At2g35060; At2g40540; At3g02050; At4g13420; At4g19960; At4g23640; At4g33530; At5g09400; At5g14880; F17M5.1; F17O7.17; F18F4.60; F1C9.17; F23F1.18; F9D16.110; GSVIVT00000271001; GSVIVT00002512001; GSVIVT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | potassium:sodium symporter activity | GO:0009674 | Molecular Function | 0.0 | - |
Sma3 | potassium ion transmembrane transporter activity | GO:0015079 | Molecular Function | 0.0 | - |
Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
Sma3 | potassium ion transport | GO:0006813 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Zinc finger, NF-X1-type | IPR000967 | - | 0.0 | - |
Sma3 | Single-stranded nucleic acid binding R3H | IPR001374 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | K+ potassium transporter | IPR003855 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | IPR018519 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G19960.1 | KUP9, ATKUP9, HAK9, KT9 K+ uptake permease 9 chr4:10813807-10816997 FORWARD LENGTH=823 | 5.0e-24 | 83% |
RefSeq | Arabidopsis thaliana | NP_001190775.1 | K+ uptake permease 9 [Arabidopsis thaliana] | 6.0e-24 | 83% |
RefSeq | Populus trichocarpa | XP_002303503.1 | predicted protein [Populus trichocarpa] | 1.0e-24 | 83% |
Full-Lengther Next Prediction |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5A8F8
Fln msg: Distance to subject end: 194 aas, W2: There is no M at the beginning, your sequence is shorter than subject: 79 - 250
Fln protein:
V
Protein Length:
80
Fln nts:
C
Fln Alignment:
GG46A6U01DJVS8___YTELVNGVPRIFSHFITHLPAIHSIVVFVCVKYLPVNTVPQAERFLVRRIGPKD
D5A8F8_______________YTELVTGIPANFTHFVTNLPAFHQVLIFICIKSVPVPYVPPEERFLIGRVGPKE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain