UniGene Name: sp_v3.0_unigene68933
Length: 173 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene68933
C |
Ace file of the UniGene sp_v3.0_unigene68933
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 (Fragment) n=1 Tax=Physcomitrella patens subsp. patens RepID=A9SJ64_PHYPA | - | - | 7.0e-18 | 87% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Sma3 | Histone acetyltransferase | - | - | 2.306e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Histone acetyltransferase. | EC:2.3.1.48 | - | 8.244e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At3g54610; CHLREDRAFT_142398; GCN5; GSVIVT00023827001; GSVIVT00023830001; HAC104; HAG1; HAG1501; HAG903; HAT1; LOC_Os10g28040; Os10g0415900; OsI_33575; OsJ_31522; PHYPADRAFT_130814; POPTRDRAFT_559629; RCOM_0991560; T14E10.180; VITISV_007738; VITISV_039350 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | histone acetyltransferase complex | GO:0000123 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | histone acetyltransferase activity | GO:0004402 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | N-acetyltransferase activity | GO:0008080 | Molecular Function | 0.0 | - |
| Sma3 | H3 histone acetyltransferase activity | GO:0010484 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Sma3 | root morphogenesis | GO:0010015 | Biological Process | 0.0 | - |
| Sma3 | chromatin modification | GO:0016568 | Biological Process | 0.0 | - |
| Sma3 | histone acetylation | GO:0016573 | Biological Process | 0.0 | - |
| Sma3 | GO:0045941 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | GNAT domain | IPR000182 | - | 0.0 | - |
| Sma3 | Bromodomain | IPR001487 | - | 0.0 | - |
| Sma3 | Acyl-CoA N-acyltransferase | IPR016181 | - | 0.0 | - |
| Sma3 | Bromodomain, conserved site | IPR018359 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G54610.1 | HAT1, GCN5, HAG1, HAC3, HAG01, BGT histone acetyltransferase of the GNAT family 1 chr3:20213593-20217375 FORWARD LENGTH=568 | 9.0e-22 | 79% |
| RefSeq | Arabidopsis thaliana | NP_567002.1 | histone acetyltransferase GCN5 [Arabidopsis thaliana] | 1.0e-21 | 79% |
| RefSeq | Populus trichocarpa | XP_002306812.1 | histone acetyltransferase [Populus trichocarpa] | 1.0e-21 | 83% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPU6
Fln msg: Distance to subject end: 179 aas, your sequence is shorter than subject: 57 - 630
Fln protein:
V
Protein Length:
58
Fln nts:
C
Fln Alignment:
GG46A6U01CDV9X___FTKEIKLEKERWHGYIKDYDGGILMECKIDPKLPYTDLPAMIRWQRQTI
B8LPU6_______________FTKEIDLEKERWHGYIKDYDGVILMECKIDPKLPYTDLPAMIRRQRQTL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta