|
||||||
|
UniGene Name: sp_v3.0_unigene68925
Length: 161 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene68925
C |
|
Ace file of the UniGene sp_v3.0_unigene68925
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | heat shock transcription factor HSF1 [Arabidopsis thaliana] | - | - | 7.0e-18 | 87% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | Heat shock factor protein, putative | - | - | 1.975e-18 | - |
| Source | Gene names |
|---|---|
| Sma3 | 23.t00064; At1g32330; At1g46264; At1g67970; At2g26150; At2g41690; At3g02990; At3g22830; At3g24520; At3g51910; At3g63350; At4g11660; At4g13980; At4g17750; At4g18880; At4g36990; At5g03720; At5g16820; At5g43840; At5g45710; At5g54070; At5g62020; B1060H01.5; B |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | response to high light intensity | GO:0009644 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | positive gravitropism | GO:0009958 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Sma3 | response to hydrogen peroxide | GO:0042542 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | lateral root development | GO:0048527 | Biological Process | 0.0 | - |
| Sma3 | fruit morphogenesis | GO:0048530 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Heat shock factor (HSF)-type, DNA-binding | IPR000232 | - | 0.0 | - |
| Sma3 | Winged helix-turn-helix transcription repressor DNA-binding | IPR011991 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G26150.1 | ATHSFA2, HSFA2 heat shock transcription factor A2 chr2:11135856-11137217 FORWARD LENGTH=345 | 6.0e-24 | 78% |
| RefSeq | Arabidopsis thaliana | NP_180184.1 | heat stress transcription factor A-2 [Arabidopsis thaliana] | 8.0e-24 | 78% |
| RefSeq | Populus trichocarpa | XP_002309214.1 | predicted protein, partial [Populus trichocarpa] | 5.0e-25 | 80% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUX6
Fln msg: Distance to subject end: 350 aas, your sequence is shorter than subject: 53 - 489
Fln protein:
R
Protein Length:
54
Fln nts:
C
Fln Alignment:
GG46A6U01DEI5I___SLIVWNSHQFSSDLLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFA
A9NUX6_______________SFVVWNSHLFSSDLLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
