UniGene Name: sp_v3.0_unigene68924
Length: 160 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene68924
C |
Ace file of the UniGene sp_v3.0_unigene68924
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cysteine proteinase (Fragment) n=1 Tax=Dendrobium hybrid cultivar RepID=A8UXB9_9ASPA | - | - | 2.0e-16 | 73% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
| Sma3 | Cysteine proteinase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 1.476e-11 | - |
| Sma3 | Hydrolases, Acting on peptide bonds (peptide hydrolases), Cysteine endopeptidases. | EC:3.4.22.- | - | 5.7e-24 | - |
| Source | Gene names |
|---|---|
| Sma3 | 6J23.30; AT1G47128; AsNODf32; At3g19390; At3g19400; At3g19400/MLD14.12; At3g48350; At3g48350/T29H11_130; At4g36880; At5g43060; At5g43060/MMG4.7; At5g50260; B1417F08.21; BoCysP1; C7A10.480; CP1; CP2; CP6; CPRF; CPRZ; CSCP; CYP1; CYS2; CYSEP; Cys; CysEP; Cy |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasmic vesicle | GO:0031410 | Cellular Component | 0.0 | - |
| Sma3 | cysteine-type endopeptidase activity | GO:0004197 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Granulin | IPR000118 | - | 0.0 | - |
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Peptidase C1A, papain C-terminal | IPR000668 | - | 0.0 | - |
| Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
| Sma3 | Ribosomal protein L5 | IPR002132 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | Phospholipase A2, active site | IPR013090 | - | 0.0 | - |
| Sma3 | Peptidase C1A, papain | IPR013128 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I29, cathepsin propeptide | IPR013201 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | IPR018069 | - | 0.0 | - | |
| Sma3 | Heat shock protein DnaJ, conserved site | IPR018253 | - | 0.0 | - |
| Sma3 | Ribosomal protein L29, conserved site | IPR018254 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G48350.1 | Cysteine proteinases superfamily protein chr3:17905752-17907370 FORWARD LENGTH=364 | 2.0e-20 | 68% |
| RefSeq | Arabidopsis thaliana | NP_566901.1 | putative cysteine proteinase [Arabidopsis thaliana] | 2.0e-20 | 68% |
| RefSeq | Populus trichocarpa | XP_002321654.1 | predicted protein [Populus trichocarpa] | 6.0e-21 | 71% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LMA7
Fln msg: Distance to subject end: 45 aas, your sequence is shorter than subject: 53 - 372
Fln protein:
V
Protein Length:
54
Fln nts:
C
Fln Alignment:
GG46A6U01CKU5N___HGEGVFTGQCGTELDHGVVVVGYGKSSEGVNYWIVRNSWGPDWGEE
B8LMA7_______________YSTGVFTGKCGTELDHGVVVVGYGKSPEGINYWIVRNSWGPEWGEQ

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta