UniGene Name: sp_v3.0_unigene68889
Length: 219 nt
![]() |
---|
>sp_v3.0_unigene68889
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | mate efflux domain-containing protein [Arabidopsis thaliana] gb|AAK53040.1|AF375456_1 AT5g65380/MNA5_11 [Arabidopsis thaliana] dbj|BAB11560.1| unnamed protein product [Arabidopsis thaliana] gb|AAN28899.1| At5g65380/MNA5_11 [Arabidopsis thaliana] gb|AED980 | - | - | 1.0e-21 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
Sma3 | Multidrug resistance pump, putative | - | - | 5.434e-39 | - |
Source | Gene names |
---|---|
Sma3 | 117M18_21; 117M18_23; AT1G61890; AT4G21910; AT4g00350; AT4g21900; AT4g25640; A_IG005I10.20; At1g11670; At1g33090; At1g33100; At1g47530; At1g61890; At3g21690; At4g00350; At4g21900; At4g21910; At4g25640; At5g10420; At5g44050; At5g65380; DDTFR18; F12B17_230; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | drug transmembrane transporter activity | GO:0015238 | Molecular Function | 0.0 | - |
Sma3 | antiporter activity | GO:0015297 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | drug transmembrane transport | GO:0006855 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G65380.1 | MATE efflux family protein chr5:26123241-26126352 REVERSE LENGTH=486 | 5.0e-28 | 71% |
RefSeq | Arabidopsis thaliana | NP_201341.1 | mate efflux domain-containing protein [Arabidopsis thaliana] | 7.0e-28 | 71% |
RefSeq | Populus trichocarpa | XP_002310871.1 | predicted protein [Populus trichocarpa] | 6.0e-29 | 76% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVJ0
Fln msg: Distance to subject end: 66 aas, your sequence is shorter than subject: 72 - 503
Fln protein:
V
Protein Length:
73
Fln nts:
C
Fln Alignment:
GG46A6U01CC83G___VFTSSTVIIKAVSKLAILLAFTVLLNSVQPVLSGVAVGSGWQAYVAWINIGCYYVIGVPLGVLL
A9NVJ0_______________IFTDSAVIIKAVSKLAYLLSFTILLNSVQPVLSGVAIGSGWQSIVAYVNIGCYYVIGVPFGVLL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain