|
||||||
|
UniGene Name: sp_v3.0_unigene68871
Length: 236 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene68871
C |
|
Ace file of the UniGene sp_v3.0_unigene68871
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Whole genome shotgun sequence of line PN40024, scaffold_11.assembly12x (Fragment) n=1 Tax=Vitis vinifera RepID=D7T8W2_VITVI | - | - | 1.0e-18 | 59% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
| Sma3 | Zinc finger protein, putative | - | - | 2.295e-33 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Acting on ester bonds, Carboxylic ester hydrolases. | EC:3.1.1.- | - | 1.069e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 1.069e-06 | % | |
| Sma3 | Bisphenol degradation | 00363 | 1.069e-06 | % | |
| Sma3 | Glycerophospholipid metabolism | 00564 | 1.069e-06 | % | |
| Sma3 | Toluene degradation | 00623 | 1.069e-06 | % | |
| Sma3 | Aminobenzoate degradation | 00627 | 1.069e-06 | % | |
| Sma3 | Retinol metabolism | 00830 | 1.069e-06 | % | |
| Sma3 | Tropane, piperidine and pyridine alkaloid biosynthesis | 00960 | 1.069e-06 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g53920; At1g71120; At5g22810; B1370C05.17; F23N20.11; GLIP5; GLIP6; GSVIVT00019185001; GSVIVT00021723001; GSVIVT00030446001; GSVIVT00034011001; GSVIVT00034013001; GSVIVT00034014001; GSVIVT00034015001; GSVIVT00038099001; MRN17.4; OJ1435_F07.7; Os06g0351 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | lipase activity | GO:0016298 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity, acting on ester bonds | GO:0016788 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminotransferase, class V/Cysteine desulfurase | IPR000192 | - | 0.0 | - |
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Lipase, GDSL | IPR001087 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
| Sma3 | Lipase, GDSL, active site | IPR008265 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G71120.1 | GLIP6 GDSL-motif lipase/hydrolase 6 chr1:26821072-26822420 REVERSE LENGTH=362 | 8.0e-21 | 65% |
| RefSeq | Arabidopsis thaliana | NP_177268.1 | GDSL esterase/lipase 6 [Arabidopsis thaliana] | 1.0e-20 | 65% |
| RefSeq | Populus trichocarpa | XP_002311486.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-20 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LR47
Fln msg: Distance to subject end: 285 aas, atg_distance in limit (1-15): atg_distance = 11, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 76 - 373
Fln protein:
P
Protein Length:
77
Fln nts:
C
Fln Alignment:
GG46A6U01CL99A___LSLILSFPFATAIRYNVPAMFIFGDSLADAGTNNFIANTTSKANFPPYGETFFHHPTGRFTNGRTTFDFIASKL
B8LR47_______________LMLLLSFPLATATNHNVPAIFIFGDSLADAGNNNFIANTTAKANFTPYGETFFHRPTGRFSNGRTAFDFIASKL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
