UniGene Name: sp_v3.0_unigene68801
Length: 176 nt
![]() |
---|
>sp_v3.0_unigene68801
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Inorganic phosphate transporter 2 n=9 Tax=Andropogoneae RepID=Q49B45_MAIZE | - | - | 4.0e-13 | 69% |
FL-Next | tr=Putative phosphate transporter; Cryptomeria japonica (Japanese cedar) (Cupressus japonica). | - | - | 0.0 | 73% |
Sma3 | H(+)/Pi cotransporter | - | - | 6.325e-21 | - |
Source | Gene names |
---|---|
Sma3 | APT1; APT2; At2g38940; At3g54700; At5g43340; At5g43350; At5g43360; At5g43370; EcPT2; EcPT3; EcPT5; EdPT1; GSVIVT00020255001; GSVIVT00020257001; HORvu; LOC_Os03g05620; LOC_Os03g05640; LePT1; LjPT2; MWF20.3; MWF20.4; MWF20.5; MWF20.6; NtPT2; Os03g0150800; O |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | inorganic phosphate transmembrane transporter activity | GO:0005315 | Molecular Function | 0.0 | - |
Sma3 | symporter activity | GO:0015293 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | phosphate ion transport | GO:0006817 | Biological Process | 0.0 | - |
Sma3 | cellular response to phosphate starvation | GO:0016036 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Hydroxymethylglutaryl-CoA reductase, class I/II | IPR002202 | - | 0.0 | - |
Sma3 | Phosphate permease | IPR004738 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Major facilitator superfamily | IPR011701 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G43340.1 | " PHT6, PHT1;6 phosphate transporter 1;6 chr5:17393598-17395148 REVERSE LENGTH=516" | 2.0e-14 | 80% |
RefSeq | Arabidopsis thaliana | NP_199148.1 | putative inorganic phosphate transporter 1-6 [Arabidopsis thaliana] | 2.0e-14 | 80% |
RefSeq | Populus trichocarpa | XP_002315705.1 | high affinity inorganic phosphate transporter [Populus trichocarpa] | 2.0e-14 | 75% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q1XG57
Fln msg: Separated hits, possible frame ERROR between 66 and 68, Distance to subject end: 214 aas, your sequence is shorter than subject: 59 - 544
Fln protein:
R
Protein Length:
60
Fln nts:
C
Fln Alignment:
GG46A6U01BHV16___SFGLFSRAFARRHGVxHLLGATSTWFLIDIVFYSQNLFQKDIFTDLKWLPS
Q1XG57_______________SFGLFSAQFAKRHGLxHLLGTTSTWLLLDVAYYSQNLFQKDIFTAIGWIPA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain