UniGene Name: sp_v3.0_unigene68738
Length: 219 nt
![]() |
---|
>sp_v3.0_unigene68738
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | FAD linked oxidase, N-terminal [Medicago truncatula] | - | - | 8.0e-17 | 62% |
FL-Next | sp=Cytokinin dehydrogenase 3; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 71% |
Sma3 | Cytokinin oxidase | - | - | 3.54e-38 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cytokinin dehydrogenase. | EC:1.5.99.12 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Zeatin biosynthesis | 00908 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At1g75450; At2g19500; At2g41510; At3g63440; At4g29740; At5g21482; At5g56970; B1046G12.8; B1131G07.3; B1131G07.5; B1150F11.25; BoCKX1; BrCKX1; CKX; CKX1; CKX10; CKX2; CKX3; CKX4; CKX5; CKX6; CKX7; F13M11.?; F1B16.2; F3P11.10; GSVIVT00013006001; GSVIVT00014 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | primary amine oxidase activity | GO:0008131 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | cytokinin dehydrogenase activity | GO:0019139 | Molecular Function | 0.0 | - |
Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
Sma3 | cytokinin metabolic process | GO:0009690 | Biological Process | 0.0 | - |
Sma3 | cytokinin catabolic process | GO:0009823 | Biological Process | 0.0 | - |
Sma3 | inflorescence development | GO:0010229 | Biological Process | 0.0 | - |
Sma3 | meristem development | GO:0048507 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxygen oxidoreductase covalent FAD-binding site | IPR006093 | - | 0.0 | - |
Sma3 | FAD linked oxidase, N-terminal | IPR006094 | - | 0.0 | - |
Sma3 | Cytokinin dehydrogenase 1, FAD/cytokinin binding domain | IPR015345 | - | 0.0 | - |
Sma3 | FAD-binding, type 2 | IPR016166 | - | 0.0 | - |
Sma3 | FAD-binding, type 2, subdomain 1 | IPR016167 | - | 0.0 | - |
Sma3 | FAD-linked oxidase, FAD-binding, subdomain 2 | IPR016168 | - | 0.0 | - |
Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G75450.1 | CKX5, ATCKX5, ATCKX6 cytokinin oxidase 5 chr1:28315248-28318064 REVERSE LENGTH=540 | 4.0e-21 | 65% |
RefSeq | Arabidopsis thaliana | NP_177678.2 | cytokinin dehydrogenase 5 [Arabidopsis thaliana] | 5.0e-21 | 65% |
RefSeq | Populus trichocarpa | XP_002307681.1 | cytokinin oxidase [Populus trichocarpa] | 2.0e-21 | 75% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8LNV6
Fln msg: Distance to subject end: 326 aas, your sequence is shorter than subject: 73 - 527
Fln protein:
R
Protein Length:
74
Fln nts:
C
Fln Alignment:
GG46A6U01B9B82___IDVLKATLRVGLAPRSWTDYLPLSVGGTLSNGGVSGQTFKFGPQISNVLNLHVVSG
Q8LNV6_______________IELLEQSLKLGLAPRSWTDYLYLTIGGTLSNAGISGQTFKHGPQISNVLQLEVVTG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain