UniGene Name: sp_v3.0_unigene68699
Length: 236 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene68699
G |
Ace file of the UniGene sp_v3.0_unigene68699
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Meiotic recombination protein DMC1 homolog n=1 Tax=Glycine max RepID=DMC1_SOYBN | - | - | 3.0e-20 | 86% |
| FL-Next | tr=RAD51-like protein; Pinus sylvestris (Scots pine). | - | - | 0.0 | 63% |
| Sma3 | Meiotic recombination protein DMC1 homolog | - | - | 3.125e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | At3g22880; CHLREDRAFT_190735; CHLREDRAFT_196696; DMC1; DMC1-A; DMC1-B; DMC1A; DMC1B; F5N5.6; GSVIVT00016363001; GSVIVT00020065001; LIM15; LOC_Os12g04980; MICPUCDRAFT_58104; MICPUN_112646; OSTLU_17346; OSTLU_33041; Os11g0146800; Os12g0143800; OsDMC1; OsDMC |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | damaged DNA binding | GO:0003684 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | DNA-dependent ATPase activity | GO:0008094 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
| Sma3 | DNA metabolic process | GO:0006259 | Biological Process | 0.0 | - |
| Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
| Sma3 | DNA recombination | GO:0006310 | Biological Process | 0.0 | - |
| Sma3 | reciprocal meiotic recombination | GO:0007131 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Helix-hairpin-helix motif | IPR000445 | - | 0.0 | - |
| Sma3 | IPR001553 | - | 0.0 | - | |
| Sma3 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR003583 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Meiotic recombinase Dmc1 | IPR011940 | - | 0.0 | - |
| Sma3 | DNA recombination/repair protein Rad51 | IPR011941 | - | 0.0 | - |
| Sma3 | DNA recombination and repair protein Rad51, C-terminal | IPR013632 | - | 0.0 | - |
| Sma3 | DNA recombination and repair protein, RecA-like | IPR016467 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G22880.1 | ATDMC1, DMC1, ARLIM15 DNA repair (Rad51) family protein chr3:8097948-8100740 REVERSE LENGTH=344 | 8.0e-23 | 73% |
| RefSeq | Arabidopsis thaliana | NP_188928.2 | meiotic recombination protein DMC1-like protein [Arabidopsis thaliana] | 1.0e-22 | 73% |
| RefSeq | Populus trichocarpa | XP_002314664.1 | predicted protein [Populus trichocarpa] | 3.0e-23 | 69% |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: G9I492
Fln msg: your sequence is shorter than subject: 54 - 323
Fln protein:
A
Protein Length:
55
Fln nts:
G
Fln Alignment:
GG46A6U01CX4NX___GGHVLAHASTVRLMFRKGKGEQRICKIYDS
G9I492_______________GGNIIAHASTTRLSLRKGRGEERICKVISS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta