SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene68688

Length: 153 nt

UniGene Fasta

>sp_v3.0_unigene68688
TGGAGGCAGCAGTGGAGAACGCTGCTCATGCAAGTTCTAAGAGGAGCAAATGGCAATTTATGGGTGCAAGAGATGCAGGTGCAAAAGAGGAGCTGCGACTTGTTTATGGTGTATCTGAAAGAACAGAAAGTGATGGAGCTGCAAATTTAGTGC

Ace file of the UniGene sp_v3.0_unigene68688

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Dicer-like protein n=1 Tax=Populus trichocarpa RepID=B9GRS6_POPTR	-	-	8.0e-17	88%
FL-Next	sp=Endoribonuclease Dicer homolog 1; Arabidopsis thaliana (Mouse-ear cress).	-	-	0.0	85%

Source	Gene names
Sma3	At1g01040; CAF; DCL1a; DCL1b; DCL902; GSVIVT00026189001; LOC_Os03g02970; MtrDRAFT_AC150443g32v2; OJ1705B08.11; Os03g0121800; OsI_09779; OsJ_09217; PHYPADRAFT_205895; POPTRDRAFT_552372; PpDCL1a; RCOM_1340690; SIN1; SUS1; T25K16.4;

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	nuclear dicing body	GO:0010445	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	double-stranded RNA binding	GO:0003725	Molecular Function	-
Sma3	helicase activity	GO:0004386	Molecular Function	-
Sma3	ribonuclease III activity	GO:0004525	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	ATP-dependent helicase activity	GO:0008026	Molecular Function	-
Sma3	cytokinesis	GO:0000910	Biological Process	-
Sma3	RNA processing	GO:0006396	Biological Process	-
Sma3	virus induced gene silencing	GO:0009616	Biological Process	-
Sma3	embryonic pattern specification	GO:0009880	Biological Process	-
Sma3	flower development	GO:0009908	Biological Process	-
Sma3	vegetative to reproductive phase transition of meristem	GO:0010228	Biological Process	-
Sma3	production of ta-siRNAs involved in RNA interference	GO:0010267	Biological Process	-
Sma3	production of lsiRNA involved in RNA interference	GO:0010599	Biological Process	-
Sma3	primary miRNA processing	GO:0031053	Biological Process	-
Sma3	mRNA cleavage involved in gene silencing by miRNA	GO:0035279	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Ribonuclease III domain	IPR000999	-	-
Sma3	Double-stranded RNA-binding	IPR001159	-	-
Sma3	Helicase, C-terminal	IPR001650	-	-
Sma3	Argonaute/Dicer protein, PAZ	IPR003100	-	-
Sma3	Dicer double-stranded RNA-binding fold	IPR005034	-	-
Sma3	Helicase/UvrB domain	IPR006935	-	-
Sma3	DNA/RNA helicase, DEAD/DEAH box type, N-terminal	IPR011545	-	-
Sma3	Helicase, superfamily 1/2, ATP-binding domain	IPR014001	-	-
Sma3		IPR014021	-	-
Sma3	Double-stranded RNA-binding-like	IPR014720	-	-
Sma3	Aldo/keto reductase, conserved site	IPR018170	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G01040.2	DCL1 dicer-like 1 chr1:23519-31079 FORWARD LENGTH=1910	4.0e-21	85%
RefSeq	Arabidopsis thaliana	NP_171612.1	endoribonuclease Dicer [Arabidopsis thaliana]	5.0e-21	85%
RefSeq	Populus trichocarpa	XP_002302679.1	dicer-like protein [Populus trichocarpa]	4.0e-22	88%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q9SP32

Fln msg: Distance to subject end: 1378 aas, your sequence is shorter than subject: 50 - 1909

Fln protein: EAAVENAAHASSKRSKWQFMGARDAGAKEELRLVYGVSERTESDGAANLV

Protein Length: 51

Fln nts: TGGAGGCAGCAGTGGAGAACGCTGCTCATGCAAGTTCTAAGAGGAGCAAATGGCAATTTATGGGTGCAAGAGATGCAGGTGCAAAAGAGGAGCTGCGACTTGTTTATGGTGTATCTGAAAGAACAGAAAGTGATGGAGCTGCAAATTTAGTGC

Fln Alignment:

GG46A6U01BJQOS___AAVENAAHASSKRSKWQFMGARDAGAKEELRLVYGVSERTESDGAANLV
Q9SP32_______________AAVEEAAQASSRKSKWQFMGARDAGAKDELRQVYGVSERTESDGAANLI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain