UniGene Name: sp_v3.0_unigene68606
Length: 240 nt
UniGene Fasta |
---|
>sp_v3.0_unigene68606
C |
Ace file of the UniGene sp_v3.0_unigene68606 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Retrotransposon protein, putative, unclassified n=1 Tax=Oryza sativa Japonica Group RepID=Q53NJ3_ORYSJ | - | - | 3.0e-18 | 61% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 41% |
Sma3 | Retrotransposon protein, putative, unclassified | - | - | 3.994e-07 | - |
Source | Gene names |
---|---|
Sma3 | 19.t00005; LOC_Os03g05350; LOC_Os10g28310; LOC_Os10g40890; LOC_Os11g08610; LOC_Os11g45000; LOC_Os12g24050; OSIGBa0114M03.4; OSIGBa0118P15.5; OSJNBa0004B23.3; OSJNBa0004L19.22; OSJNBa0010C11.17; OSJNBa0041A02.23; OSJNBa0053B21.11; OSJNBa0067N01.10; OSJNBa0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Ribosomal protein S15 | IPR000589 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | S15/NS1, RNA-binding | IPR009068 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Putative Complete
Fln database: coniferopsida.fasta
Fln subject: A9NWN2
Fln msg: STOP codon was not found. Distance to subject end: 6 aas,
Fln protein:
M
Protein Length:
68
Fln nts:
C
Fln Alignment:
GG46A6U01C91Q2___YSSLMVMVLKKDGEWHMCPDFKALNKLTVKDKFPISIVDDFLDELNKAQFFTKLHLSSGYHQIHM
A9NWN2_______________YSTPIILVRINDGSYILCNNCRVLNEITIKDKFHISIVDELLDELYGTMYFLELDQKSNYYHIRV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain